KEGG   Mus musculus (mouse): 50778Help
Entry
50778             CDS       T01002                                 

Gene name
Rgs1, BL34
Definition
(RefSeq) regulator of G-protein signaling 1
  KO
K16449  regulator of G-protein signaling
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RGS DUF4038 zf-C4H2
Motif
Other DBs
NCBI-GeneID: 50778
NCBI-ProteinID: NP_056626
MGI: 1354694
Ensembl: ENSMUSG00000026358
Vega: OTTMUSG00000035154
UniProt: Q9JL25
Position
1 F; 1 62.56 cM
AA seq 209 aa AA seqDB search
MRAAAISMPRLNKMPGMFFSASPKDSKEHSHSLLDDKKQKKRPKTFGMDVKTYLRSMIPH
LESGMKSAKSKDILSAEEVMQWSQSLEKLLANQTGQNVFGRFLKSEFSEENIEFWLACED
YKKTETDLLHNKAENIYKAFVHSDAVKQINIDFHTRESTAKKIKTPTPTSFDEAQKVIYS
LMEKDSYPRFLKSNIYLNLLNDLQANTLK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggcagccatctccatgccaaggttgaacaaaatgccaggaatgttcttttct
gctagcccaaaggattcgaaagaacacagccattctcttctagacgacaaaaagcagaaa
aaaaggccaaagacttttggaatggacgtgaaaacatacctgagatcgatgatcccacat
ctggaatctgggatgaaatcggccaagtccaaagacatactttctgctgaagaagtaatg
cagtggtctcagtctctggaaaaactccttgccaaccagacaggtcaaaatgtctttgga
agatttctaaagtctgaattcagtgaggaaaatattgaattctggttggcttgtgaggac
tataagaaaacagagactgatcttttgcataacaaagcagagaatatatacaaagcattt
gtgcattcagatgctgtgaaacaaatcaatattgacttccatactcgagaatcgacagcc
aagaagattaaaacaccaactcccacatcttttgatgaagcacaaaaagtcatatattca
ctcatggaaaaagattcttatcccaggttcctgaaatcaaatatttacttaaatcttcta
aatgaccttcaggcaaatactttaaagtga

DBGET integrated database retrieval system