KEGG   Mus musculus (mouse): 50780
Entry
50780             CDS       T01002                                 

Symbol
Rgs3, 4930506N09Rik, C2PA-RGS3, C2pa, PDZ-RGS3, RGS3S
Name
(RefSeq) regulator of G-protein signaling 3
  KO
K07524  regulator of G-protein signalling 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    50780 (Rgs3)
SSDB
Motif
Pfam: RGS PDZ PDZ_6 Peptidase_M50 PDZ_2
Other DBs
NCBI-GeneID: 50780
NCBI-ProteinID: NP_599018
MGI: 1354734
Ensembl: ENSMUSG00000059810
Vega: OTTMUSG00000000313
UniProt: Q9DC04
Structure
Position
4:62478079..62621256
AA seq 966 aa
MNRFNGLCKVCSERRYRQITIRRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTV
LQLNERPVEHWKCVELAHEIRSCPSEIILLVWRVVPQIKPGPDGGVLRRASCKSTHDLLS
PPNKREKNCTHGAPVRPEQRHSCHLVCDSSDGLLLGGWERYTEVGKRSGQHTLPALSRTT
TPTDPNYIILAPLNPGSQLLRPVYQEDTIPEEPGTTTKGKSYTGLGKKSRLMKTVQTMKG
HSNYQDCSALRPHIPHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGR
NKTSQVTLFAYSDLLLFTKEEEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAE
CLFTLEAHSQEQKKRVCWCLSENIAKQQQLAAPPTERKMFETEADEKEMPLVEGKGPGAE
EPAPSKNPSPGQELPPGQDLPPSKDPSPSQELPAGQDLPPSKDPSPSQELPAGQDLPPSK
DPSPSQELPVGQDLPPRKDSSGQEAAPGPESPSSEDIATCPKPPQSPETSTSKDSPPGQG
SSPTTELPSCQGLPAGQESTSQDPLLSQEPPVIPESSASVQKRLPSQESPSSLGSLPEKD
LAEQTISSGEPPVATGAVLPASRPNFVIPEVRLDNAYSQLDGAHGGSSGEDEDAEEGEEG
GEGEEDEEDDTSDDNYGDRSEAKRSSLIETGQGAEGGFSLRVQNSLRRRTHSEGSLLQES
RGPCFASDTTLHCSDGEGATSTWAIPSPRTLKKELGRNGGSMHHLSLFFTGHRKMSGTDL
TECDEASRKRKSKNIAKDMKNKLAIFRRRNESPGAQPASKTDKTTKSFKPTSEEALKWSE
SLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAI
QACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQK
KMSPPL
NT seq 2901 nt   +upstreamnt  +downstreamnt
atgaaccgcttcaatgggctctgcaaagtgtgttcagaacgccgctaccggcagatcacc
atccggaggggcaaagacggctttggcttcaccatctgctgtgactctccggtccgagtc
caggctgtggattctgggggcccggcagagagggcgggactgcagcagctggacacagtg
ctacaactgaatgagagacccgtggagcactggaaatgtgtggagctggcacatgagatc
cggagctgtcctagcgagatcatcctgctcgtgtggcgtgtggtcccccagatcaagccg
gggccagatggcggagtcttgcggcgggcctcctgcaagtccacacatgacctcctgtca
ccccctaacaagagggagaagaactgtactcatggggccccagttcgtcctgagcagcgc
cacagctgccacctggtgtgtgacagctctgatggtctactgcttggtggctgggagcgc
tacactgaggtgggcaagcgcagtggccagcacaccctgcctgcactgtcccggaccacc
acccctactgaccccaactacatcatcctggccccactgaatcctggaagccagttgctg
cggcctgtgtaccaggaggatacaatccctgaagaaccggggactactactaaagggaaa
tcgtacaccggcctgggcaagaagtctcggctcatgaagacagtgcagaccatgaagggc
cacagtaactaccaagactgctcagccctgagaccgcacatcccgcattccagttacggc
acctatgtcaccctggcccctaaagtcctggtgttccctgtctttgtgcagcccctagat
ctctgtaaccctgcccggactctcctgctgtcggaggagctgctgctgtatgaggggagg
aacaagacttcccaggtgacactgtttgcctactcggacctgctgctgttcactaaggag
gaggagccaggccgctgcgacgtcctgagaaatcccctctacctccagagcgtgaagcta
caggagggctcttcagaagacttgaaattctgtgtgctgtacctggcagagaaggcagag
tgcttattcactttggaggcacactcgcaggagcagaagaagagagtgtgctggtgcctg
tcggagaacatcgccaagcagcaacagctggccgcaccacctacagagaggaagatgttt
gagacagaggcagatgagaaggagatgcccctggtcgaggggaaggggccaggtgctgag
gaacccgcacccagcaaaaatccctctcctggccaggagcttcctccaggacaagacctc
cctcccagcaaagacccctctcccagccaggagcttcctgcaggacaagatctccctccc
agcaaagacccctctcccagccaggagcttcctgcaggacaagatctccctcccagcaaa
gacccctctcccagccaggagcttcctgtaggacaagacctcccacccaggaaggactcc
tcaggccaagaagctgctcctggcccagaatcaccatccagtgaagacatagcaacctgc
cctaagccccctcaaagcccagaaacctcaacaagcaaggactccccaccaggccaggga
tcctccccgaccacagaactcccatcttgccagggccttcctgctggtcaagaatctact
agccaggaccctctgctcagtcaagagccccctgttatcccagaatcctctgcctccgtc
cagaaacgcctaccctctcaggagtcaccctccagcctgggctccctgccagagaaggac
cttgctgagcagaccatcagctccggggagccaccagtcgccactggtgctgtactgcca
gcctctagacctaactttgtgatccccgaggtgcgtctggataatgcctacagccaactg
gatggggcccacggaggcagctctggcgaggacgaggatgcagaagagggagaggagggg
ggagaaggggaggaagatgaggaggacgacaccagcgacgacaactacggggatcgtagt
gaggccaagcgcagcagcctgattgagactggccaaggcgccgagggcggcttctcgttg
cgtgtgcagaactcgctgcggcgccggacgcacagcgagggcagcctgctgcaggagtcc
cgggggccctgctttgcctctgacaccaccttacactgctctgatggcgagggcgccaca
tccacctgggctatcccttcaccccgcaccctcaaaaaagaactgggtcgtaatggaggc
tccatgcaccacctttccctgttcttcacgggacacaggaagatgagtgggactgacctc
acagaatgtgatgaagcttcccggaagagaaagagcaaaaacatagccaaggacatgaag
aataagctggccatcttcaggcggcggaacgaatctcccggggctcagccagccagcaag
acagacaagacaaccaagtccttcaagcctacctcggaggaagccctcaagtggagcgag
tccctggaaaagttgctgcttcataaatatggcttagaagtgttccaggccttccttcgc
accgagttcagtgaggagaacctggagttttggctcgcttgcgaggacttcaagaaggtc
aaatcacagtccaagatggcagccaaagccaagaagatctttgctgaattcatcgcaatc
caggcttgcaaagaggtaaacctggactcctacacacgagaacacaccaaggagaatctg
cagagcatcacccgaggctgctttgacttggcacagaaacgtatctttgggctcatggag
aaggactcttaccctcgcttcctccgctctgacctctacctggacctcattaaccagaag
aagatgagtcccccgctctag

DBGET integrated database retrieval system