KEGG   Mus musculus (mouse): 50782Help
Entry
50782             CDS       T01002                                 

Gene name
Rgs11, C78048
Definition
(RefSeq) regulator of G-protein signaling 11
  KO
K16449  regulator of G-protein signaling
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    50782 (Rgs11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS_DHEX RGS DEP G-gamma
Motif
Other DBs
NCBI-GeneID: 50782
NCBI-ProteinID: NP_001074538
MGI: 1354739
Ensembl: ENSMUSG00000024186
Vega: OTTMUSG00000026502
UniProt: G3X8W6
Position
17; 17 A3.3
AA seq 466 aa AA seqDB search
MAMVTRCTPHGGCSRMQRPHLSKMERVVVSMQDPDQGVKMRSQRLLITVIPHAVAGRDLV
EWLVQKFCILEDEALHLGTLLAQHGYIYPLRESRDLTLRPDETPYRFQTPYFWTSTMWPA
AELDYAIYLAKKNIQKQGALVDYEKEHYALLHKKINHAWDLVLMQAREQLRAAKQRRKGD
RMVISCQEQTYWLVNKPPPGAPNILEQGPERGSYNPSHMQMSSDFYKCEIECFRKALGRN
RVKSSACLEAYLKFSSQHGPHDPIMSGCLPSNPWITDDVTYWAMNAPNVAAPTKLRVERW
SFSFRELLDDPVGRAHFMDFLQKEFSAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLA
PGAARWINIDSRTMERTLEGLRQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGLLEE
AVIPLETKRWPFPFLRKPLHSSPSPALQSTPREPAATSSPEGADGE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggccatggttacccgctgcacaccccacggcgggtgctcccgaatgcagagaccgcat
ctcagcaagatggagcgggtagtcgtgagtatgcaggaccctgaccaaggcgtgaagatg
cggagccagcgccttctgatcactgtcattccccacgcggtagcgggcagagacctcgtg
gaatggctggttcagaagttctgcatcttggaggatgaagccctgcacctgggcacactc
ctggcgcagcacggctacatctacccactgcgtgagtcccgagacctgacactcaggccg
gacgagaccccctacaggttccagacaccctacttttggacaagcactatgtggccagct
gctgagctagactatgccatctatctggctaagaagaacatccaaaaacaaggggcttta
gtggactatgagaaggaacattatgccctgctgcacaagaagatcaaccatgcatgggat
ctggtattgatgcaggctcgagagcagctgcgggctgctaagcagcggcggaagggagac
agaatggtcatttcgtgtcaggagcagacatactggctggtgaataagccccctcctggg
gcacctaacattttggagcagggtcctgagaggggctcttacaaccccagtcacatgcag
atgagctcggatttctataagtgtgagatcgagtgcttcaggaaggcactgggcaggaac
cgggtgaagtcctctgcctgcctcgaggcgtacctgaagttcagcagccagcacgggccg
catgatcccatcatgtcagggtgtctgcccagcaacccctggatcacagatgatgtcacc
tactgggccatgaatgcgcccaacgtggctgcccccacaaaactccgcgttgagcgatgg
agcttcagcttccgggagctgctggatgaccccgtggggcgtgcccacttcatggacttt
ctccagaaggaattcagtgcggaaaacctcagcttctgggaggcatgtgaggagctgcgc
tttggcggacaggcccaggtccccaccttggtggactctgtgtatcagcagttcctggcc
cctggagctgcccgctggatcaacattgacagcaggacgatggagcggaccctggagggt
ctgcgccagccacaccgctatgtcctggatgcagcacagcttcacatctacatgctcatg
aagaaggactcctatccaaggttcctgaagtctgacatatacaagggcctgctggaggaa
gctgtgattccactggagacaaagcgctggccatttccattcttgcggaagcctctgcac
tcaagccccagccctgctctccagtctacccccagggagcctgcagcaaccagttcccct
gaaggtgccgatggggagtag

DBGET integrated database retrieval system