KEGG   Mus musculus (mouse): 50790
Entry
50790             CDS       T01002                                 

Gene name
Acsl4, 9430020A05Rik, AC, ACS4, AU018108, Fac, Facl4, La, Lacs4
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00071  Fatty acid degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
mmu04216  Ferroptosis
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
Module
mmu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    50790 (Acsl4)
   00071 Fatty acid degradation
    50790 (Acsl4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    50790 (Acsl4)
  09143 Cell growth and death
   04216 Ferroptosis
    50790 (Acsl4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    50790 (Acsl4)
   03320 PPAR signaling pathway
    50790 (Acsl4)
  09159 Environmental adaptation
   04714 Thermogenesis
    50790 (Acsl4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    50790 (Acsl4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    50790 (Acsl4)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     50790 (Acsl4)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   50790 (Acsl4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   50790 (Acsl4)
  Exosomal proteins of breast cancer cells
   50790 (Acsl4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 50790
NCBI-ProteinID: NP_997508
MGI: 1354713
Ensembl: ENSMUSG00000031278
Vega: OTTMUSG00000018811
UniProt: Q9QUJ7
Position
X; X F2
AA seq 711 aa
MNLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYR
SVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPNGKVFKKLIL
GNYKWINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTL
YATLGREAVVHGLNESEASYLITSVELLESKLKAALVDINCVKHIIYVDNKTINRAEYPE
GLEIHSMQSVEELGAKPENLSVPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMT
GQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSK
GDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYVQKTLFKIGYDYKLEQIKKGYDAPLC
NLILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEV
TDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYFKNEEKTAED
YCVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDN
ICAFAKSDQSYVISFVVPNQKKLTLLAQQKGVEGSWVDICNNPAMEAEILKEIREAANAM
KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGGK
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgaaccttaagctaaatgtgctcaccattatattgctgcctgtccacttgttaataaca
atatacagtgcccttatatttattccatggtattttcttaccaatgccaagaagaaaaac
gctatggcaaagagaataaaagctaagcccacttcagacaaacctggaagtccatatcgc
tctgtcacacacttcgactcactagctgtcatagacatccctggagcagatactctggat
aaattatttgaccatgctgtagccaaatttgggaagaaggacagccttggaacccgggag
atcctgagtgaagaaaatgaaatgcagccaaatggaaaggtttttaagaagttaattctt
gggaattataaatggataaactatcttgaagtgaactgcagagtgaataactttggaagt
ggcctcactgcattgggactgaaaccaaagaacaccattgccattttctgtgagaccagg
gcagagtggatgattgcagcacagacttgctttaagtacaactttccacttgtgacttta
tatgccacacttggcagagaagctgtagttcatggattaaatgaatctgaggcttcctat
ctgattactagtgttgagcttctggaaagcaaactgaaggcggccttagtagatatcaat
tgtgttaaacatatcatttatgtggataataagactatcaatagagcagagtaccctgag
gggcttgaaattcacagcatgcaatcagtagaggagctgggagccaagccagaaaacttg
agcgttcctccaagtagaccaaccccttcagacatggccattgtcatgtacaccagtggt
tctacgggccgccccaagggagtgatgatgcatcatagcaatttgattgctggaatgaca
ggccagtgtgaacgtatccctggactaggaccgaaggacacatatattggctacttacct
ttggctcatgtgctggaactgacagcagagatatcatgctttacctatggctgtaggatt
ggatactcttcaccccttacactgtctgaccagtccagcaaaatcaagaagggaagcaag
ggtgattgtactgtactgaaacccacacttatggccgctgttccggaaatcatggataga
atttataagaatgttatgagcaaggttcaagagatgaattatgttcagaaaactctattt
aaaatcgggtatgattacaaattagagcaaatcaagaaaggctatgacgcccctctttgt
aatctgatactgtttaaaaaggtgaaggctctgctgggagggaatgtccgcatgatgctg
tctggcggcgcgccactgtcccctcagacacaccgattcatgaatgtctgcttctgctgc
cccattggtcagggatatgggctgacagaatcatgtggtgctggaacagttactgaagtt
actgactacactactggaagagttggagctcctcttatttgctgtgaaattaaactgaaa
gactggcaggaaggtggttatacagttcatgataagccgaaccccagaggtgagattgtg
atcggtggccagaatatctccatgggatattttaaaaacgaagagaaaacagcagaagat
tattgtgttgatgaaaatggacaaaggtggttttgcactggcgatattggagaattccat
cctgatggatgcttacagattatagatcgtaagaaagatctggtaaagttacaagcagga
gaatatgtatctcttgggaaagtagaagctgcactgaagaattgtccactgatcgacaac
atctgtgcttttgccaaaagtgaccagtcctatgtgatcagttttgtggttcctaaccag
aaaaagttgactcttttggcacaacagaagggggtagaaggatcttgggttgatatttgc
aataatcccgccatggaagctgaaatactgaaagaaattcgagaagctgcaaatgccatg
aaattggagcgatttgaaattccgatcaaggttcggttaagcccagagccatggaccccc
gagactggtttggtaacagatgccttcaagctgaaaaggaaggagttgaagaaccattat
ctcaaagacattgagcgaatgtatgggggcaaataa

DBGET integrated database retrieval system