KEGG   Mus musculus (mouse): 50794
Entry
50794             CDS       T01002                                 

Gene name
Klf13, 0610043C13Rik, 9430029L20Rik, Bteb3, FKLF-, FKLF-2, FKLF2, Klf1, N, NSLP1, RFL, RFLA, RFLAT-1, RFLAT1
Definition
(RefSeq) Kruppel-like factor 13
  KO
K09208  krueppel-like factor 9/13/14/16
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    50794 (Klf13)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    50794 (Klf13)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8 DUF5810 zf-Di19 PAP_PilO
Other DBs
NCBI-GeneID: 50794
NCBI-ProteinID: NP_067341
MGI: 1354948
Ensembl: ENSMUSG00000052040
Vega: OTTMUSG00000044885
UniProt: Q9JJZ6
Position
7; 7 C
AA seq 289 aa
MAAAAYVDHFAAECLVSMSSRAVVHEPREGPEPRPEGAAAAAPTLPRVDERRDGKDSASL
FVVARILADLNQQAPAPAPAERREGAAARKARTPCRLPPAPPAPPPGPEPASPGQAGAPA
APPSPAWSEPEAALEQEPGPAGSGEPGLRQRGRRGRSRADLESPQRKHKCHYAGCEKVYG
KSSHLKAHLRTHTGERPFACSWQECNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRS
DHLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSPTISPASSP
NT seq 870 nt   +upstreamnt  +downstreamnt
atggcagccgccgcctatgtggaccactttgccgccgagtgcctcgtgtccatgtccagc
cgcgcagtcgtgcacgagccgcgggaaggacctgaaccccggcccgagggcgcggccgcc
gccgcccccacactgccccgcgttgacgagcgccgcgacggcaaggacagcgcctcgctt
ttcgtggtggctcggatcctagcggacctcaaccagcaggcgccggcgcccgcccccgcg
gaacgcagagaaggggccgctgcgcgcaaggcgaggaccccctgccgcctgccgcctgcg
ccccctgcgccgccacccggcccagagcccgcctccccgggacaagcaggcgcgccggcc
gcgccccccagccccgcgtggagcgagccggaggcggcattggagcaggagcccggcccc
gcggggagcggcgagcctggcctcagacaaaggggtcggcgaggccggagccgcgcggac
ctcgagtccccgcagaggaagcacaagtgccactacgcgggctgcgagaaagtttacggg
aaatcttcgcacctcaaggcgcacctgagaactcacacaggtgagaggcctttcgcctgc
agctggcaggagtgcaacaagaagttcgcacgctcggacgagctggcacggcactatcgc
acgcacacgggcgagaagaagttcagctgccccatctgtgagaagcgcttcatgcggagc
gaccacctgacgaagcacgcacgccgccacgccaacttccacccaggcatgctgcagcgg
cgcggcgggggctcgaggaccggctcgctcagcgactacagccgctccgatgccagcagc
cccaccatcagcccggccagctcaccctga

DBGET integrated database retrieval system