KEGG   Mus musculus (house mouse): 50796
Entry
50796             CDS       T01002                                 
Symbol
Dmrt1
Name
(RefSeq) doublesex and mab-3 related transcription factor 1
  KO
K19488  doublesex- and mab-3-related transcription factor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    50796 (Dmrt1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other transcription factors
   DMRT
    50796 (Dmrt1)
SSDB
Motif
Pfam: Dmrt1 DM
Other DBs
NCBI-GeneID: 50796
NCBI-ProteinID: NP_056641
MGI: 1354733
Ensembl: ENSMUSG00000024837
UniProt: Q9QZ59
Position
19:25482982..25581692
AA seq 374 aa
MPNDDTFGKPSTPTEVPHAPGAPPQGKAGGYSKAAGAMAGAAGGSGAGGSGGASGSGPSG
LGSGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMAAQVALR
RQQAQEEELGISHPIPLPSAAELLVKRENNASNPCLMAENSSSAQPPPASTPTPAASEGR
MVIQDIPAVTSRGHMENTSDLVSDPAYYSSFYQPSLFPYYNNLYNYPQYSMALSAESSSG
EVGNSLGGSPVKNSLRSLPAPYVPAQTGNQWQMKTSESRHPVSSQYRMHSYYGPPSYLGQ
SMSQIFTFEEGPSYSEAKASVFSPPSSQDSGLVSLSSSSPMSNESSKGVLECESASSEPS
SYAVNQVLEEDEDE
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgccgaacgacgacacattcggcaagccctctaccccgacggaggttcctcacgctccc
ggggccccgccgcagggcaaagccggaggttacagcaaagctgccggggcgatggctgga
gcggctggaggctcgggcgcggggggcagcggaggtgcctcgggctccgggccgtcgggc
ctgggttctggaagcaagaagtccccgaggctgcccaaatgcgctcgctgcaggaaccac
ggctacgcgtcgccgctcaagggccacaagcgcttctgcatgtggcgggattgccagtgc
aagaagtgcagcctgattgcggagcgacagcgggtgatggccgcgcaggtggccctgaga
agacagcaggcccaggaagaagaactgggtatcagccacccaattccgctgcccagcgca
gccgagctcctggtcaaaagagagaataatgccagcaacccgtgcctgatggccgagaac
agcagctctgcccagcccccaccggccagcaccccaacccccgctgcctcagagggacgc
atggtcatccaggatattcctgctgtcaccagcagagggcatatggagaacacatctgac
ctggtatcagaccccgcctactacagcagcttttaccagccttctctgtttccttactac
aacaatctgtacaactacccccagtattccatggccttgtctgctgagtcctcctcaggg
gaggtggggaattccctcgggggatcccccgtgaagaacagcctgcggagtctcccagca
ccttacgtgcctgctcagactggaaaccagtggcagatgaagacctcagagagccgccac
ccagtgagctcccagtaccggatgcactcatactacgggcctccctcctacctgggccag
agcatgtcccagatctttaccttcgaggaaggcccctcctactcagaagccaaagccagt
gtgttctcgccccccagcagtcaagattctggcttggtctccctctccagcagctctccg
atgagcaacgagagctcgaagggagttctggaatgtgagtctgcgtcctcggaacctagc
agctacgccgtcaaccaggtcctggaagaggatgaggacgagtga

DBGET integrated database retrieval system