KEGG   Mus musculus (mouse): 50798Help
Entry
50798             CDS       T01002                                 

Gene name
Gne, 2310066H07Rik, DMRV, GLCNE, IBM2, NM, Uae1
Definition
(RefSeq) glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase
  KO
K12409  bifunctional UDP-N-acetylglucosamine 2-epimerase / N-acetylmannosamine kinase [EC:3.2.1.183 2.7.1.60]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    50798 (Gne)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.60  N-acylmannosamine kinase
     50798 (Gne)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.183  UDP-N-acetylglucosamine 2-epimerase (hydrolysing)
     50798 (Gne)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase_2 ROK Hexokinase_1 DRTGG FGGY_N Glucokinase
Motif
Other DBs
NCBI-GeneID: 50798
NCBI-ProteinID: NP_001177343
MGI: 1354951
Ensembl: ENSMUSG00000028479
Vega: OTTMUSG00000007208
UniProt: Q91WG8 Q3TCI8
Position
4; 4 B1
AA seq 722 aa AA seqDB search
MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPAFFELDVVVLGSHLIDDYGNTYRM
IEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDRFDALALA
TSAALMNIRILHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHLISMCEDHDRILL
AGCPSYDKLLSAKNKDYMSIIRMWLGDDVKCKDYIVALQHPVTTDIKHSIKMFELTLDAL
ISFNKRTLVLFPNIDAGSKEMVRVMRKKGIEHHPNFRAVKHVPFDQFIQLVAHAGCMIGN
SSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKI
YGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLR
VAIVSMKGEIVKKYTQFNPKTYEERISLILQMCVEAAAEAVKLNCRILGVGISTGGRVNP
QEGVVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAAMAERKFGQGKGQENFVTL
ITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYASGMALQREA
KKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNVKAQSILRTAGTALGLGVVNILHTM
NPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRR
IH
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaacgggaacaaccgaaagctccgggtttgcgttgccacctgcaaccgagct
gactactccaaactggccccgatcatgttcggcatcaagacagagcccgcgttctttgag
ttggacgtggtggtgctcggctcccacctgattgacgactatggaaacacataccgcatg
attgagcaagatgactttgacattaacaccaggctccacacgattgttagaggggaagat
gaagcggccatggtagagtcggtaggcctagcgctcgtgaagctaccggacgtcctcaat
cgcctgaagcccgacatcatgattgttcacggagaccgatttgacgcccttgctctggct
acgtctgctgccttgatgaacatccgcatccttcacattgaaggaggcgaggtcagcggg
accattgatgactctatcagacacgccataacaaaactggctcactaccatgtgtgctgc
actagaagtgcagagcagcacctgatctctatgtgcgaggaccacgaccgcatcctgttg
gcaggctgcccttcctatgacaaactgctctccgccaagaacaaagactatatgagcatc
attcggatgtggctaggcgatgatgtaaaatgtaaggattacatcgttgccctgcagcat
cccgtgaccactgacattaagcattccataaagatgtttgagctaacactggatgccctg
atctcgtttaacaagaggaccctagttctgtttccaaatatcgatgcaggcagcaaggag
atggttcgagtgatgcggaagaagggcatcgagcatcaccccaatttccgtgcagtcaag
cacgtcccgtttgaccagttcatacagctggtcgcccacgctggctgcatgattgggaat
agcagctgcggcgtgcgagaggttggcgctttcggaacacccgtgatcaacctgggcaca
aggcagataggaagagaaaccggggagaatgttcttcatgtcagggatgctgacacccaa
gataaaatattgcaagcactacacctccagttcggcaaacagtacccttgctcaaagata
tatggggatgggaatgctgttccaaggattttaaagtttctcaaatccattgaccttcaa
gagccactacagaagaaattctgcttcccccctgtaaaggagaacatctctcaagacatt
gaccacatcctggaaactctgagtgccttggctgttgatcttggcgggacaaacctgagg
gtggcaatagttagcatgaagggtgaaatcgttaagaagtacactcagttcaaccctaaa
acctatgaagaaaggattagtttaatcctgcagatgtgtgtggaagctgccgcggaagct
gtgaaactcaattgcagaattctgggagtaggcatctccacaggtggccgcgtgaatccc
caggaaggagttgtgctgcattcaaccaagctgatccaggaatggaactccgtggacctc
aggacacccctctccgacaccctgcatctccccgtgtgggtggacaatgacggcaactgt
gccgccatggcagagaggaagttcggccaaggaaaaggacaggagaacttcgtgacgctc
atcacggggacagggatcggtggggggatcatccaccagcacgaactgatccacggcagc
tccttctgcgcggcggagctcggccatctcgtggtgtccctggacggtcctgactgctcc
tgtggaagccatgggtgcatcgaagcgtacgcctctggaatggccttgcagagggaagca
aagaaactccatgatgaggacctgctcttggtggaagggatgtcagtaccaaaagacgaa
gctgtgggtgccctccatctcatccaggctgccaagctgggcaacgtgaaggcccagagc
atcttacgaacagctggaactgctttgggacttggggttgtgaacatcctccacactatg
aatccttccctggtgatcctgtctggagtcctggccagtcactacatccacatcgtgaag
gacgtcatccgccagcaagccttgtcctccgtgcaggatgtggacgtggtggtctcagac
ttggtggacccggccctgcttggcgcagccagcatggttctggactacacaacgcgcagg
atccactag

DBGET integrated database retrieval system