KEGG   Mus musculus (house mouse): 50868
Entry
50868             CDS       T01002                                 
Symbol
Keap1, INRF2, mKIAA0132
Name
(RefSeq) kelch-like ECH-associated protein 1
  KO
K10456  kelch-like protein 19
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05012  Parkinson disease
mmu05200  Pathways in cancer
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    50868 (Keap1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50868 (Keap1)
   05208 Chemical carcinogenesis - reactive oxygen species
    50868 (Keap1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    50868 (Keap1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    50868 (Keap1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    50868 (Keap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50868 (Keap1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     50868 (Keap1)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_3 BTB Kelch_2 Kelch_4 Kelch_5
Other DBs
NCBI-GeneID: 50868
NCBI-ProteinID: NP_001103775
MGI: 1858732
Ensembl: ENSMUSG00000003308
UniProt: Q9Z2X8
Structure
Position
9:complement(21141026..21150628)
AA seq 624 aa
MQPEPKLSGAPRSSQFLPLWSKCPEGAGDAVMYASTECKAEVTPSQDGNRTFSYTLEDHT
KQAFGVMNELRLSQQLCDVTLQVKYEDIPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISVGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCTELHQRAREYIYMHFGEVAKQEEFFNLSHCQLATLISRDDLNVR
CESEVFHACIDWVKYDCPQRRFYVQALLRAVRCHALTPRFLQTQLQKCEILQADARCKDY
LVQIFQELTLHKPTQAVPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgcagcccgaacccaagcttagcggggctccccgcagcagccagttcctgcccctgtgg
tcaaagtgccccgagggggccggggacgcagtgatgtatgcctccacggagtgcaaggca
gaggtgacgccctcgcaggacggtaaccgaaccttcagctacacactagaggatcacacc
aagcaggcttttggcgtcatgaacgagcttcgcctgagccagcaactctgtgacgtgacc
ctgcaggtcaaatatgaggacatcccagctgcccaattcatggctcacaaagtggtgctg
gcctcctccagcccagtctttaaagccatgttcaccaacgggcttcgggagcagggcatg
gaggtggtgtccatcgaaggcatccaccctaaggtcatggaaaggcttattgagttcgcc
tacacggcctccatctccgtgggcgagaagtgtgtcctgcacgtgatgaacggggcggtc
atgtaccagattgacagcgtggttcgagcctgcagcgacttcctcgtgcagcagctggac
cccagcaacgccattggcatcgccaacttcgcggagcagatcggctgcactgaactgcac
cagcgtgcccgggagtatatctacatgcacttcggggaggtggccaagcaggaggagttc
ttcaacctgtcacactgccagctggccacgctcatcagccgggatgatctgaacgtacgc
tgcgagtccgaggtgttccacgcgtgcatcgactgggtcaaatacgactgcccgcagcgg
cgcttctacgtgcaggcactgctgcgggccgtgcgctgccatgcgctcacgccgcgcttc
ctgcagacgcagctgcagaagtgtgagatcctgcaggccgacgcgcgctgcaaggactac
ctggtgcagatattccaggagctcacgctgcacaagcccacgcaggcagtgccctgccgc
gcgcccaaagtgggccgcctcatctacacagcgggcggttacttccgacagtcgctcagc
tacctggaggcctacaacccgagcaatggctcctggctgcgcctggccgatctacaggtg
ccgcgcagtgggctggcaggctgcgtggtgggtgggctgctatacgctgtgggcggccgc
aacaactctccggatggcaacactgactccagcgccctggactgctacaaccccatgacc
aaccagtggtcgccctgtgcctctatgagcgtgccacgcaaccgcatcggggtgggggtc
atagatggccacatctacgcagtcgggggttcccacggctgcatccaccacagcagcgtg
gagagatatgagccagagcgggacgagtggcatctagtcgcgccaatgttgacacggagg
attggcgtgggcgtggcagtgctcaaccgcttgctgtatgcagtggggggctttgacggg
actaaccggcttaactccgcagaatgttactatccagagaggaatgagtggcggatgatc
acaccgatgaataccatccggagcggggccggggtctgcgtgctgcacaactgtatctat
gcagcagggggctacgatgggcaggaccagttgaacagtgtggagcgctacgacgtggag
acagagacctggactttcgtagcccccatgaggcatcaccgtagtgcgctggggattact
gtgcaccagggcaagatctacgtcctcggaggctatgatggccacacttttctggacagt
gtggaatgctatgacccggacagtgatacctggagtgaggtgacccgcatgacatctggc
cgcagcggggtgggtgtggccgtcaccatggaaccctgtcggaagcaaattgatcaacaa
aactgtacctgctga

DBGET integrated database retrieval system