KEGG   Mus musculus (mouse): 50873
Entry
50873             CDS       T01002                                 

Gene name
Prkn, P, Pa, Park2
Definition
(RefSeq) parkin RBR E3 ubiquitin protein ligase
  KO
K04556  parkin [EC:2.3.2.31]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04137  Mitophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50873 (Prkn)
   04120 Ubiquitin mediated proteolysis
    50873 (Prkn)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    50873 (Prkn)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    50873 (Prkn)
   05014 Amyotrophic lateral sclerosis
    50873 (Prkn)
   05022 Pathways of neurodegeneration - multiple diseases
    50873 (Prkn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    50873 (Prkn)
   04121 Ubiquitin system [BR:mmu04121]
    50873 (Prkn)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    50873 (Prkn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     50873 (Prkn)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    50873 (Prkn)
  Aggrephagy
   Other aggrephagy associated proteins
    50873 (Prkn)
  Xenophagy
   Other xenophagy associated proteins
    50873 (Prkn)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    50873 (Prkn)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    50873 (Prkn)
SSDB
Motif
Pfam: zf-RING_14 zf-RING_12 ubiquitin IBR Rad60-SLD DUF2407 Rad60-SLD_2
Other DBs
NCBI-GeneID: 50873
NCBI-ProteinID: NP_057903
MGI: 1355296
Ensembl: ENSMUSG00000023826
Vega: OTTMUSG00000046340
UniProt: Q9WVS6
Structure
PDB: 
2ZEQ 3B1L 1MG8

Position
17 A1; 17 7.8 cM
AA seq 464 aa
MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCD
LEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLA
VILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPS
CWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIAC
TDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKEL
HHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG
FVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRC
NVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatagtgtttgtcaggttcaactccagctatggcttcccagtggaggtcgattctgac
accagcatcttgcagctcaaggaagtggttgctaagcgacagggggttccagctgaccag
ctgcgtgtgatttttgccgggaaggagcttccgaatcacctgacggttcaaaactgtgac
ctggaacaacagagtattgtacacatagtacagagaccacggaggagaagtcatgaaaca
aatgcatctggaggggacgaaccccagagcacctcagagggctccatatgggagtccagg
agcttgacacgagtggacctgagcagccataccctgccggtggactctgtggggctggcg
gtcattctggacacagacagtaagagggattcagaagcagccagaggtccagttaaaccc
acctacaacagctttttcatctactgcaaaggcccctgccacaaggtccagcctggaaag
ctccgagttcagtgtggcacctgcaaacaagcaaccctcaccttggcccagggcccatct
tgctgggacgatgtcttaattccaaaccggatgagtggtgagtgccagtctccagactgc
cctggaaccagagctgaatttttctttaaatgtggagcacacccaacctcagacaaggac
acgtcggtagctttgaacctgatcaccagcaacaggcgcagcatcccttgcatagcgtgc
acagatgtcaggagccctgtcctggtcttccagtgtaaccaccgtcacgtgatctgtttg
gactgtttccacttgtattgtgtcacaagactcaacgatcggcagtttgtccacgatgct
caacttggctactccctgccgtgtgtagctggctgtcccaactccctgattaaagagctc
catcacttcaggatccttggagaagagcagtacactaggtaccagcagtatggggccgag
gaatgcgtgctgcaaatgggaggtgtgctgtgcccccgtcctggctgtggagctggactg
ctacctgaacagggccagaggaaagtcacctgcgaagggggcaacggcctgggctgcggg
tttgttttctgccgggactgtaaggaagcataccatgaaggggattgcgactcactgctc
gaaccctcaggagccacttctcaggcctacagggtggacaaaagagccgctgagcaagct
cgctgggaggaggcctccaaggaaaccatcaagaagaccaccaagccttgtcctcgctgc
aacgtgccaattgaaaaaaacggaggatgtatgcacatgaagtgtcctcagccccagtgc
aagctggagtggtgctggaactgtggctgtgagtggaaccgagcctgcatgggagatcac
tggtttgacgtgtag

DBGET integrated database retrieval system