KEGG   Mus musculus (mouse): 50875Help
Entry
50875             CDS       T01002                                 

Gene name
Tmod3, U-Tmod, UTMOD
Definition
(RefSeq) tropomodulin 3
  KO
K10370  tropomodulin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    50875 (Tmod3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     50875 (Tmod3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomodulin LRR_6 Usher
Motif
Other DBs
NCBI-GeneID: 50875
NCBI-ProteinID: NP_058659
MGI: 1355315
Ensembl: ENSMUSG00000058587
Vega: OTTMUSG00000062847
UniProt: Q9JHJ0 Q3TFA9
Position
9 D; 9 42.3 cM
AA seq 352 aa AA seqDB search
MALPFRKDLGDYKDLDEDELLGKLSESELKQLETVLDDLDPENALLPAGFRQKNQTSKSA
TGPFDRERLLSYLEKQALEHKDRDDYVPYTGEKKGKIFIPKQKPAQTLTEETISLDPELE
EALTSASDTELCDLAAILGMHNLIADTPFCDVLGSSNGVNQERFPNVVKGEKILPVFDEP
PNPTNVEESLKRIRENDARLVEVNLNNIKNIPIPTLKDFAKTLEANTHVKHFSLAATRSN
DPVAVAFADMLKVNKTLKSLNMESNFITGAGVLALIDALRDNETLMELKIDNQRQQLGTS
VELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRIEGDHQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccgttccggaaggacttgggggactacaaggacctggatgaggacgagctc
cttggcaagctgtccgaatcagagctgaaacagctggagactgtcctggatgatcttgac
cccgagaatgcccttctgcctgcagggtttcggcagaagaaccagacatcaaagtctgcc
acgggaccctttgatagagaacggctcctttcttacctagagaagcaagcattggagcac
aaagaccgggacgattatgtgccctacactggagagaagaaagggaaaatttttatcccc
aaacagaagccagcgcagactcttacagaagaaactatatccctcgacccagagttagaa
gaagctttgacaagtgcttcagacacagagctgtgcgaccttgcagctattcttgggatg
cacaatctgattgcagacacaccgttctgtgatgtgctgggaagtagtaacggtgtcaac
caagagcgttttcccaatgtggttaaaggggaaaagattcttccagtgtttgatgagcca
ccaaatccaaccaacgttgaagagagtttaaagagaattagggaaaacgatgcccgtctt
gttgaagttaatttgaataatataaaaaatatcccaattccaactctaaaagattttgca
aagactttggaagccaacacgcatgtgaaacatttcagtctcgcggccaccaggagcaat
gaccccgtggctgttgcttttgcagatatgctgaaagtgaacaaaactttgaagagctta
aatatggagtccaacttcatcacaggcgcaggggttttagcactgattgatgctttgaga
gataatgagaccctgatggagctcaagattgacaatcagagacagcagttgggcacctca
gtagaattagaaatggccaagatgcttgaggaaaatacaaatatccttaaatttggatat
cagttcacgcagcagggaccccgaaccagggcagccaacgcgataacgaagaacaatgac
ttagtgcgcaagaggcgaattgaaggagaccaccagtaa

DBGET integrated database retrieval system