KEGG   Mus musculus (mouse): 50876Help
Entry
50876             CDS       T01002                                 

Gene name
Tmod2, N-Tmod, NTMOD
Definition
(RefSeq) tropomodulin 2
  KO
K10370  tropomodulin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    50876 (Tmod2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     50876 (Tmod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomodulin LRR_6
Motif
Other DBs
NCBI-GeneID: 50876
NCBI-ProteinID: NP_001033799
MGI: 1355335
Ensembl: ENSMUSG00000032186
Vega: OTTMUSG00000062853
UniProt: Q9JKK7
Position
9 D; 9 42.31 cM
AA seq 351 aa AA seqDB search
MALPFQKGLEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESATLPAGFRQKDQTQKAA
TGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPVETRKEEKVTLDPELE
EALASASDTELYDLAAVLGVHNLLNNPKFDEETTNGEGRKGPVRNVVKGEKAKPVFEEPP
NPTNVEASLQQMKANDPSLQEVNLNNIKNIPIPTLKEFAKSLETNTHVKKFSLAATRSND
PVALAFAEMLKVNKTLKSLNVESNFITGTGILALVEALRENDTLTEIKIDNQRQQLGTAV
EMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEGDRR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcccctttcaaaaagggctggagaaatacaagaacatcgacgaagacgagctt
cttggcaaactctcagaagaggaactgaaacagttggaaaatgttctagatgacctagat
cccgagagtgcaacgctacctgctggattccgacagaaagaccagacccagaaagcagcc
actggcccatttgaccgagaacacctgctcatgtacctggagaaagaggctttggaacag
aaggacagggaggactttgtacccttcacaggagaaaagaaagggagagtctttatcccc
aaggaaaagcctgtagaaactcggaaagaagagaaagtgaccctggacccagaactggag
gaagccttggccagtgcctcagacactgaactctacgaccttgcagctgtcctcggagtc
cacaatttgctcaacaatccgaagtttgatgaagagacgaccaacggcgaaggtcgcaag
gggcctgtgaggaatgtcgtgaaaggtgaaaaggccaagccagtatttgaggagccaccg
aaccccacaaatgtggaggcaagcctgcagcagatgaaggccaacgaccccagcctgcag
gaggtcaacctcaacaacattaagaacattccaattccaaccctgaaggaatttgcaaag
tctctggagaccaacacccatgtgaagaagttcagcctggctgcaacccgcagcaatgac
cctgtggcccttgcctttgcagagatgctgaaagtcaacaagaccttgaaaagtctaaac
gtagagtccaattttatcactggcactggaatcctggccctggtggaagcgctgcgggag
aatgacaccttgacggagatcaagattgacaaccagaggcagcagttgggaacagctgtg
gagatggagatcgcccagatgctggaggagaactcaaggatcctcaagtttgggtaccag
tttaccaagcaagggccacggacaagagtggcagctgccatcacaaaaaataatgacctg
gttcgaaagaagagagttgaaggagacaggaggtaa

DBGET integrated database retrieval system