KEGG   Mus musculus (mouse): 50880Help
Entry
50880             CDS       T01002                                 

Gene name
Scly, 9830169H08, A930015N15Rik, SCL, Scly1, Scly2
Definition
(RefSeq) selenocysteine lyase
  KO
K01763  selenocysteine lyase [EC:4.4.1.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00450  Selenocompound metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    50880 (Scly)
Enzymes [BR:mmu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     50880 (Scly)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 50880
NCBI-ProteinID: NP_057926
MGI: 1355310
Ensembl: ENSMUSG00000026307
Vega: OTTMUSG00000022404
UniProt: Q9JLI6 A0A0R4J069
Position
1; 1 D
AA seq 432 aa AA seqDB search
MDAARNGALGSVESLPDRKVYMDYNATTPLEPEVIQAVTEAMKEAWGNPSSSYVSGRKAK
DIINAARASLAKMIGGKPQDIIFTSGGTESNNLVIHSMVRCFHEQQTLKGNMVDQHSPEE
GTRPHFITCTVEHDSIRLPLEHLVENQMAEVTFVPVSKVNGQAEVEDILAAVRPTTCLVT
IMLANNETGVIMPVSEISRRIKALNQIRAASGLPRVLVHTDAAQALGKRRVDVEDLGVDF
LTIVGHKFYGPRIGALYVRGVGKLTPLYPMLFGGGQEWNFRPGTENTPMIAGLGKAADLV
SENCETYEAHMRDIRDYLEERLEAEFGKRIHLNSRFPGVERLPNTCNFSIQGSQLQGYTV
LAQCRTLLASVGASCHSNHEDRPSPVLLSCGIPVDVARNAVRLSVGRGTTRADVDLIVQD
LKQAVAQLEGRL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggcgcgaaatggcgcgctgggcagtgtggagagcctacccgacaggaaggtc
tatatggactataatgccaccacacctctagagcccgaagtcatccaggctgtgacagag
gccatgaaggaagcctggggaaaccccagcagctcctatgtgtcaggtaggaaggccaag
gacattataaatgcagctcgagcgagcctggccaagatgataggtggaaagccccaggac
atcatcttcacttctgggggcaccgagtcaaataatttagtaatccactctatggtaaga
tgcttccatgaacagcagaccctgaaggggaacatggttgaccagcacagcccagaagag
gggaccaggccccattttatcacttgcacagtggaacacgactccatccggctgcccctg
gagcacctggtggaaaatcaaatggcagaggtcacttttgtcccagtgtcgaaggtgaat
gggcaggcagaggtcgaggatatcctggcggctgtccgtcccaccacatgccttgtgacc
atcatgctggccaataatgagaccggcgtcatcatgcctgtctccgagatcagtcggcga
attaaagccctgaaccagatccgggctgcctcggggctgccccgagtcctggtgcacaca
gacgctgctcaggcactggggaagaggcgagtggatgtcgaagacctgggcgtggacttc
ctgaccatcgtgggacataagttctacggccccaggatcggtgctctgtatgtacgaggg
gtcggtaaacttacccccctgtaccccatgctgtttggaggtggacaagagtggaatttc
aggccagggaccgagaacacgcccatgattgctggccttgggaaggctgctgatctggtg
agcgagaactgcgagacttatgaggcccacatgagagacatccgagattacctggaggag
aggctggaggctgagtttggtaagagaatccatttgaacagccggtttccaggagtggag
aggcttccaaacacctgcaacttttccatccaggggtcccagcttcaagggtacacggtc
cttgcacagtgccggacactgctggccagtgtgggagcatcatgccactcaaatcacgag
gaccggccatccccagtgctgctgagctgcggcattcctgtggacgtggcccggaatgca
gtccggctcagcgtgggccgcggtaccaccagggctgatgtggatctcatcgtacaggac
ctgaagcaggccgtggcccaactggaagggcggctctag

DBGET integrated database retrieval system