KEGG   Mus musculus (mouse): 50883
Entry
50883             CDS       T01002                                 

Gene name
Chek2, CHK2, Cds1, HUCDS1, Rad, Rad53
Definition
(RefSeq) checkpoint kinase 2
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    50883 (Chek2)
   04115 p53 signaling pathway
    50883 (Chek2)
   04218 Cellular senescence
    50883 (Chek2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    50883 (Chek2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     50883 (Chek2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   50883 (Chek2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    50883 (Chek2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like RIO1 Kdo APH Pkinase_fungal YrbL-PhoP_reg Haspin_kinase
Other DBs
NCBI-GeneID: 50883
NCBI-ProteinID: NP_057890
MGI: 1355321
Ensembl: ENSMUSG00000029521
Vega: OTTMUSG00000054224
UniProt: Q9Z265 Q543W6
Position
5; 5 F
AA seq 546 aa
MKSHHQSHSSTSSKAHDSASCSQSQGGFSQPQGTPSQLHELSQYQGSSSSSTGTVPSSSQ
SSHSSSGTLSSLETVSTQELCSIPEDQEPEEPGPAPWARLWALQDGFSNLDCVNDNYWFG
RDKSCEYCFDGPLLRRTDKYRTYSKKHFRIFREMGPKNCYIVYIEDHSGNGTFVNTELIG
KGKRCPLSNNSEIALSLCRNKVFVFFDLTVDDQSVYPKELRDEYIMSKTLGSGACGEVKM
AFERKTCQKVAIKIISKRRFALGSSREADTAPSVETEIEILKKLNHPCIIKIKDVFDAED
YYIVLELMEGGELFDRVVGNKRLKEATCKLYFYQMLVAVQYLHENGIIHRDLKPENVLLS
SQEEDCLIKITDFGQSKILGETSLMRTLCGTPTYLAPEVLVSNGTAGYSRAVDCWSLGVI
LFICLSGYPPFSEHKTQVSLKDQITSGKYNFIPEVWTDVSEEALDLVKKLLVVDPKARLT
TEEALNHPWLQDEYMKKKFQDLLVQEKNSVTLPVAPAQTSSQKRPLELEVEGMPSTKRLS
VCGAVL
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgaagagtcatcatcagtcccacagcagcacctcctcgaaggctcatgacagtgcttcc
tgttcacagtcccagggtggcttcagccagccccaaggcactccttctcagttgcacgag
ctctcacagtatcagggttcgtccagctcctctaccggcacagtgccgtcctccagccag
tcctcgcactccagttctgggactctgagctcgctggagacagtgtctacccaggaactc
tgttctattcctgaggaccaagaacctgaagaacctggtcctgccccttgggctcggcta
tgggctcttcaggatggattctccaatctagactgtgttaacgacaactactggtttggg
agagataaaagctgtgaatattgcttcgatggaccactgttgagaaggacggacaagtac
cggacttacagcaagaagcattttcgtattttcagggaaatgggccctaaaaattgttac
atcgtatacatagaggatcacagtggaaatggaaccttcgtaaataccgagcttattggg
aaaggcaaacgctgtcctctgagtaacaactctgaaatcgcactttcactatgtagaaat
aaagtttttgtattttttgatctgactgtagatgatcagtcagtttatcctaaggaatta
agagacgaatacatcatgtcaaaaactcttggaagtggtgcgtgtggggaggtaaagatg
gcttttgagaggaagacatgtcagaaagtggccataaagatcattagcaagcggaggttt
gctcttggctcatcgagagaagccgacacagctcccagtgtggaaactgaaatagaaatt
ttgaagaaactaaatcatccatgcatcatcaagattaaagatgtttttgatgcggaagat
tattacattgttctggaactgatggaaggaggagaactatttgaccgggtggtggggaac
aagcgcctgaaagaagccacctgtaagctctacttctaccagatgcttgtagctgtacag
taccttcacgaaaatgggatcatacatcgggacttaaagccggagaatgttcttttatca
tctcaggaagaggattgtctaatcaagatcactgactttgggcagtccaagatcttgggg
gagacctccttgatgagaaccttatgtggtacgcccacttatctggctcctgaggttctt
gtctccaacgggactgctgggtacagccgcgctgtggactgctggagtttaggagttatt
cttttcatctgcctaagtgggtatccacctttctctgagcataagacccaagtgtccctg
aaggatcagatcaccagtggaaagtacaactttattcctgaagtctggacagatgtctca
gaggaggctctggaccttgtcaagaaactgttagttgtagacccaaaggctcggcttacc
acagaggaggccttaaatcatccgtggcttcaggatgagtacatgaagaagaaatttcag
gatctcctggtgcaggaaaagaactcggtgaccctccctgtggctcccgcccagacttcc
agtcaaaagcggcccctggaactggaggtggagggtatgccgagcacaaaacgcctgtct
gtgtgtggggctgtgttgtga

DBGET integrated database retrieval system