KEGG   Mus musculus (mouse): 50907
Entry
50907             CDS       T01002                                 

Gene name
Preb, C85705
Definition
(RefSeq) prolactin regulatory element binding
  KO
K14003  prolactin regulatory element-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50907 (Preb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    50907 (Preb)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    50907 (Preb)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 50907
NCBI-ProteinID: NP_057912
MGI: 1355326
Ensembl: ENSMUSG00000045302
Vega: OTTMUSG00000022374
UniProt: Q9WUQ2 Q3UAP1
Position
5; 5 B1
AA seq 417 aa
MGRRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLELINGCLSAS
LLHSHDTETRATMNLALAGDILAAGQDAQCQLLRFQVHQQKGSKAEKSGSKEQGPRQRKG
APPAEKKSGAQVHPEGVELKVKNLEAVQTDFSNEPLQKVVCFNHDNTLLATGGTDGHVRV
WKVPSLEKVLEFKAHEGEIGDLTLGPDGKLVTVGWDFKASVWQKDQLVTQLQWQENGPAS
SNTPYRYQACRFGQVPDQLGGLRLFTVQIPHKRLRQPPPCYLTAWDSSTFLPLRTRSCGH
EVISCLSVSDSGTFLGLGTVTGSVAIYIAFSLQRLYYVKEAHGIVVTDVTFLPEKGCGPK
LLGPHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVGLIIVTILLLQTAFPGFL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggtcggcgccggggtgtggagctgtaccgggccccgttcccgttgtacgcgcttcgg
atagaccccaagactgggctgctcatcgctgcgggcggaggaggagctgccaagaccggc
ataaagaatggcgtgcattttctgcagctagagctgatcaacgggtgcctgagcgcttcc
ttgctgcactctcatgacacggagacacgggccaccatgaatttggcgcttgctggtgac
attcttgctgccggacaggatgcccagtgtcagcttcttcgtttccaggtccatcaacag
aagggcagtaaagcggagaagtcaggttccaaggagcagggacctcgacagagaaagggg
gctcctccagcagagaagaaatcgggagcacaagttcaccccgaaggggttgaactcaaa
gtaaagaatttggaggcagtacagacagacttcagcaatgaaccgctgcagaaagttgtg
tgcttcaaccatgataacaccctgcttgccactggaggaactgatggtcatgttcgtgtc
tggaaggtacctagcctggagaaagttctggagttcaaagcccatgaaggggagattgga
gatttgactttgggtcctgatggcaagctggttacagtgggctgggactttaaggcctct
gtgtggcagaaggatcaactggtgacacagctacagtggcaagagaatggaccagcctct
tctaatacaccataccgctaccaggcctgcaggtttgggcaggttccagatcagctcggt
gggctgcgactcttcacagtgcagataccccacaagcgcctacgtcagcccccaccctgc
tacctcacagcctgggacagttccaccttcttgcctcttcggaccagatcctgtggccat
gaggtcatttcctgcctcagtgtcagtgattcgggtaccttcctaggcctaggcacggtc
actggctctgtcgccatctacatagctttctctctccagcgcctgtattatgtgaaggag
gcccatggcattgtggtaacagatgtgacctttctacctgagaagggttgtggtccaaag
ctccttgggccccatgaaactgctcttttctctgtggctgtggatagtcgttgccagttg
cacctgctgccttcacggcggagtgttcctgtatggcttctgctcctgctgtgtgtcggc
cttattattgtgaccatcctgctgctccagactgccttcccgggatttctctaa

DBGET integrated database retrieval system