KEGG   Mus musculus (mouse): 50909Help
Entry
50909             CDS       T01002                                 

Gene name
C1ra, AI132558, C1r, mC1rA
Definition
(RefSeq) complement component 1, r subcomponent A
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    50909 (C1ra)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    50909 (C1ra)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    50909 (C1ra)
  09171 Infectious disease: bacterial
   05133 Pertussis
    50909 (C1ra)
   05150 Staphylococcus aureus infection
    50909 (C1ra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    50909 (C1ra)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    50909 (C1ra)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     50909 (C1ra)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   50909 (C1ra)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    50909 (C1ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF
Motif
Other DBs
NCBI-GeneID: 50909
NCBI-ProteinID: NP_075632
MGI: 1355313
Ensembl: ENSMUSG00000055172
Vega: OTTMUSG00000056669
UniProt: Q8CG16 Q9CTX0
Position
6; 6 F2
AA seq 707 aa AA seqDB search
MWLFALLVTLFYGVEGSIYLPQKLYGEVTSPLYPKPYPSDLETTTVITVPMGYRVKLVFW
QFDVEPSEGCFYDYVKISADKQTLGRFCGQLDSPLGNPPGSKEFMSQGNKMLLTFHTDFS
NEENGTIMFYKGFLAYYQAVDLDECASQPNSVEEGLQPRCQHLCHNYVGGYFCSCHPGYE
LQKDGQSCQAECSSELYTEPSGYVSSLEYPQPYPPDLRCNYSIRVERGLTVHLKFLDPFE
IDDHQQVHCPYDQLQIYANGKNLGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLH
YTTETIKCPQPKALDEFTIIQDPQPQYQFRDYFIVTCKQGYQLMEGNQALLSFTAVCQND
GTWHRAMPRCKIKNCGQPQSLSNGDFRYITTKGVTTYEASIQYHCHEPYYKMLTRAGSSE
SMRGIYTCTAQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKERIIRGQPARPGNFPWQAFT
TTHGRGGGALLGDRWILTAAHTIYPKHHNKENDNANPKMLVFLGHTNVEQIKKLGHHPVR
RVIIHPDYRQDEPNNFEGDIALLELENSVTLGPELLPICLPDNETFYGQGLMGYVSGFGI
TEDKLAFDLRFVRLPVADSEACQRWLQTKKDTSPFSQNMFCSGDPAVQQDACQGDSGGVF
AVRDRNRDIWVATGIVSWGIGCGEGYGFYTKVLNYVDWIKKEMGDEN
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctttgccctcctggtgaccctgttctatggggtggaaggctccatttacctc
cctcagaagctctatggagaggtgacctcccctctgtatcccaagccttaccccagtgac
ttggagacaaccactgtgatcactgtccccatggggtacagggtgaagctggtcttctgg
cagtttgacgtggagccttctgaaggctgcttctatgactatgttaagatttctgctgat
aagcaaacactggggaggttctgtgggcagctggattctcccctgggcaaccccccagga
agcaaggaattcatgtcccaaggaaacaagatgctgctgaccttccacacagacttctcc
aatgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaggctgta
gaccttgatgaatgtgcatcgcagcccaactcagtggaagagggtttgcagccccgatgc
caacatctgtgtcacaactatgttggaggctacttctgttcctgccatcctggctatgag
cttcagaaagatgggcaatcctgccaggctgagtgcagcagtgagctctacacagagccc
tcaggctatgtctccagccttgaataccctcagccctatccaccggatctacgctgcaac
tacagcatccgggtggagaggggcctcactgtgcacctcaagttcctggatccttttgaa
attgatgaccaccagcaagtgcactgcccctatgaccagctccagatctacgctaatggg
aagaacttgggtgaattctgtggaaagcaaaggcctccagaccttgacaccagcagcaat
gcagtggatctgctgttcttcacagatgagtcaggggacagccgaggctggaagctgcac
tacaccactgaaaccatcaagtgcccccagcccaaggctctggatgagttcaccatcatc
caggatccgcagcctcagtaccagttccgggattacttcattgtcacctgcaagcaaggc
taccagctcatggagggaaatcaggcgctactctccttcacagctgtttgccagaatgat
ggcacatggcatcgtgccatgcccaggtgcaagatcaagaactgtgggcagccccaaagc
ctgtctaatggggacttccgctacatcaccacaaaaggcgtgaccacctatgaagccagt
atccagtatcactgccatgaaccatattacaagatgctgaccagagctggcagcagcgag
tccatgcgagggatatatacctgcacagcccaaggcatttggaagaatgaagaggaagga
gagaaaatgccccggtgtctgccagtgtgtgggaaacctgtcaaccctgtgacacagaag
gagcgcatcatcagagggcagccagccaggcccggcaacttcccctggcaggccttcacc
actacccacgggcgagggggtggggccctgcttggagaccgctggatcctcacagcagcc
cacaccatctaccccaagcatcacaacaaggaaaacgacaatgccaaccccaaaatgctt
gttttcctgggccacacaaatgtggaacagatcaaaaaactgggacatcacccagtccgt
agggtcatcatacacccagactaccgccaagatgaacctaacaattttgaaggagacatt
gctctactggagctggaaaacagtgtcacactgggccccgaactcctccccatctgtctc
ccagacaatgagaccttctatggccaaggcctcatgggttatgtcagcggattcgggata
acagaagataagttagctttcgatctcaggttcgtcagactgcctgtagctgacagtgag
gcatgccagagatggctccagacaaaaaaggatacttctccattttctcaaaatatgttc
tgttctggggacccagctgtacagcaagacgcctgccaaggggacagtgggggtgttttt
gcagtcagggacagaaatcgtgatatttgggtggctacgggcatcgtatcctggggcatt
gggtgtggtgagggatatggcttctacaccaaggtactgaattatgttgactggatcaag
aaagagatgggagacgaaaactga

DBGET integrated database retrieval system