KEGG   Mus musculus (mouse): 50909
Entry
50909             CDS       T01002                                 

Gene name
C1ra, AI132558, C1r, mC1, mC1rA
Definition
(RefSeq) complement component 1, r subcomponent A
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    50909 (C1ra)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    50909 (C1ra)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    50909 (C1ra)
  09171 Infectious disease: bacterial
   05133 Pertussis
    50909 (C1ra)
   05150 Staphylococcus aureus infection
    50909 (C1ra)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    50909 (C1ra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    50909 (C1ra)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    50909 (C1ra)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     50909 (C1ra)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   50909 (C1ra)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    50909 (C1ra)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 50909
NCBI-ProteinID: NP_075632
MGI: 1355313
Ensembl: ENSMUSG00000055172
Vega: OTTMUSG00000056669
UniProt: Q8CG16 Q9CTX0
Position
6; 6 F2
AA seq 707 aa
MWLFALLVTLFYGVEGSIYLPQKLYGEVTSPLYPKPYPSDLETTTVITVPMGYRVKLVFW
QFDVEPSEGCFYDYVKISADKQTLGRFCGQLDSPLGNPPGSKEFMSQGNKMLLTFHTDFS
NEENGTIMFYKGFLAYYQAVDLDECASQPNSVEEGLQPRCQHLCHNYVGGYFCSCHPGYE
LQKDGQSCQAECSSELYTEPSGYVSSLEYPQPYPPDLRCNYSIRVERGLTVHLKFLDPFE
IDDHQQVHCPYDQLQIYANGKNLGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLH
YTTETIKCPQPKALDEFTIIQDPQPQYQFRDYFIVTCKQGYQLMEGNQALLSFTAVCQND
GTWHRAMPRCKIKNCGQPQSLSNGDFRYITTKGVTTYEASIQYHCHEPYYKMLTRAGSSE
SMRGIYTCTAQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKERIIRGQPARPGNFPWQAFT
TTHGRGGGALLGDRWILTAAHTIYPKHHNKENDNANPKMLVFLGHTNVEQIKKLGHHPVR
RVIIHPDYRQDEPNNFEGDIALLELENSVTLGPELLPICLPDNETFYGQGLMGYVSGFGI
TEDKLAFDLRFVRLPVADSEACQRWLQTKKDTSPFSQNMFCSGDPAVQQDACQGDSGGVF
AVRDRNRDIWVATGIVSWGIGCGEGYGFYTKVLNYVDWIKKEMGDEN
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgtggctctttgccctcctggtgaccctgttctatggggtggaaggctccatttacctc
cctcagaagctctatggagaggtgacctcccctctgtatcccaagccttaccccagtgac
ttggagacaaccactgtgatcactgtccccatggggtacagggtgaagctggtcttctgg
cagtttgacgtggagccttctgaaggctgcttctatgactatgttaagatttctgctgat
aagcaaacactggggaggttctgtgggcagctggattctcccctgggcaaccccccagga
agcaaggaattcatgtcccaaggaaacaagatgctgctgaccttccacacagacttctcc
aatgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaggctgta
gaccttgatgaatgtgcatcgcagcccaactcagtggaagagggtttgcagccccgatgc
caacatctgtgtcacaactatgttggaggctacttctgttcctgccatcctggctatgag
cttcagaaagatgggcaatcctgccaggctgagtgcagcagtgagctctacacagagccc
tcaggctatgtctccagccttgaataccctcagccctatccaccggatctacgctgcaac
tacagcatccgggtggagaggggcctcactgtgcacctcaagttcctggatccttttgaa
attgatgaccaccagcaagtgcactgcccctatgaccagctccagatctacgctaatggg
aagaacttgggtgaattctgtggaaagcaaaggcctccagaccttgacaccagcagcaat
gcagtggatctgctgttcttcacagatgagtcaggggacagccgaggctggaagctgcac
tacaccactgaaaccatcaagtgcccccagcccaaggctctggatgagttcaccatcatc
caggatccgcagcctcagtaccagttccgggattacttcattgtcacctgcaagcaaggc
taccagctcatggagggaaatcaggcgctactctccttcacagctgtttgccagaatgat
ggcacatggcatcgtgccatgcccaggtgcaagatcaagaactgtgggcagccccaaagc
ctgtctaatggggacttccgctacatcaccacaaaaggcgtgaccacctatgaagccagt
atccagtatcactgccatgaaccatattacaagatgctgaccagagctggcagcagcgag
tccatgcgagggatatatacctgcacagcccaaggcatttggaagaatgaagaggaagga
gagaaaatgccccggtgtctgccagtgtgtgggaaacctgtcaaccctgtgacacagaag
gagcgcatcatcagagggcagccagccaggcccggcaacttcccctggcaggccttcacc
actacccacgggcgagggggtggggccctgcttggagaccgctggatcctcacagcagcc
cacaccatctaccccaagcatcacaacaaggaaaacgacaatgccaaccccaaaatgctt
gttttcctgggccacacaaatgtggaacagatcaaaaaactgggacatcacccagtccgt
agggtcatcatacacccagactaccgccaagatgaacctaacaattttgaaggagacatt
gctctactggagctggaaaacagtgtcacactgggccccgaactcctccccatctgtctc
ccagacaatgagaccttctatggccaaggcctcatgggttatgtcagcggattcgggata
acagaagataagttagctttcgatctcaggttcgtcagactgcctgtagctgacagtgag
gcatgccagagatggctccagacaaaaaaggatacttctccattttctcaaaatatgttc
tgttctggggacccagctgtacagcaagacgcctgccaaggggacagtgggggtgttttt
gcagtcagggacagaaatcgtgatatttgggtggctacgggcatcgtatcctggggcatt
gggtgtggtgagggatatggcttctacaccaaggtactgaattatgttgactggatcaag
aaagagatgggagacgaaaactga

DBGET integrated database retrieval system