KEGG   Mus musculus (mouse): 50918Help
Entry
50918             CDS       T01002                                 

Gene name
Myadm, D7Wsu62e
Definition
(RefSeq) myeloid-associated differentiation marker
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL
Motif
Other DBs
NCBI-GeneID: 50918
NCBI-ProteinID: NP_001087233
MGI: 1355332
Ensembl: ENSMUSG00000068566
Vega: OTTMUSG00000057713
UniProt: O35682 Q0VE46
Position
7 A1; 7 1.92 cM
AA seq 320 aa AA seqDB search
MPVTVTRTTITTTTSSSTTVGSARALTQPLGLLRLLQLISTCVAFSLVASVGAWTGPMGN
WAMFTWCFCFAVTLIILIVELGGLQAHFPLSWRNFPITFACYAALFCLSSSIIYPTTYVQ
FLAHGRTRDHAIAATTFSCVACLAYATEVAWTRARPGEITGYMATVPGLLKVFETFVACI
IFAFISEPLLYNQKPALEWCVAVYAICFILAGVTILLNLGDCTNVLPIPFPTFLSGLALL
SVLFYATAIVLWPLYQFDQRYQGQPRRSMDPSCTRSISYIQPNTVCFWDRRLAVSILTGI
NLLAYVSDLVYSTRLVFVKV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaacagtaactcgtacaaccatcacgactacaacgtcatcctccaccactgtg
gggtccgctcgggcgctgacccagccgctgggcctcctccgcctcctgcagctaatatcc
acctgtgtggctttctcgctggtggccagtgtgggtgcctggacagggcccatgggtaac
tgggccatgttcacctggtgtttctgctttgctgttaccctcatcatcctgattgtggag
ttaggtggactccaggcccacttccccctgtcatggcgaaacttccccatcacctttgcc
tgctacgcggccctcttctgcctgtcgtcttccatcatctatcccaccacctatgtgcag
ttcctagctcatggacgtacccgggaccatgccatcgctgccaccactttctcctgcgtt
gcctgtttggcgtatgccactgaagtggcctggacccgtgcaaggcccggtgagatcact
ggctatatggctaccgtgccagggctgctcaaagtttttgagaccttcgtagcctgtatc
atctttgccttcatcagtgagccgctcctgtataatcagaagccagccctggagtggtgt
gtggcagtctatgccatctgcttcatactagcaggggtgaccatcctgctcaacctgggg
gattgtaccaacgtgttgcccatccctttccccaccttcctctcaggcttggccttactc
tctgttctcttttacgccactgccatcgtcctctggcccctctaccaatttgatcagaga
tatcagggccaaccccgccgttcaatggatccaagctgcactcgtagtattagttatata
caacccaacacggtgtgtttctgggaccgacgactggcggtgtccatcctgacaggtatc
aacctgctggcatatgtgtctgatctggtgtactccactcgtctggtgttcgtcaaggtc
tga

DBGET integrated database retrieval system