KEGG   Mus musculus (house mouse): 50927
Entry
50927             CDS       T01002                                 
Symbol
Nasp, 5033430J04Rik, D4Ertd767e, Epcs32, Nasp-T
Name
(RefSeq) nuclear autoantigenic sperm protein (histone-binding)
  KO
K11291  nuclear autoantigenic sperm protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    50927 (Nasp)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     50927 (Nasp)
SSDB
Motif
Pfam: SHNi-TPR TPR_2 TPR_12 TPR_1 TPR_8 TPR_14
Other DBs
NCBI-GeneID: 50927
NCBI-ProteinID: NP_001074944
MGI: 1355328
Ensembl: ENSMUSG00000028693
UniProt: Q99MD9 B1AU76
Position
4:complement(116458249..116488894)
AA seq 448 aa
MATESTAAAAIAAELVSADKIEDAPAPSTSADKMESLDVDSEAKKLLGLGQKHLVMGDIP
AAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEEG
EKTEDESLVENNDNVDETEGSEEEDRENDKAEETPNESVLEKKSLQENEEEEIGNLELAW
DMLDLAKIIFKRQETKEAQLYAAQAHLKLGEVSVESENYIQAVEEFQACLSLQEQYLEAH
DRLLAETHYQLGLAYGYNSQYDEAVAQFGKSIDVIEKRMAVLHEQMKEAEGSFTEYEKEI
EELKELLPEIREKIEDAKESQRSGNVAELALKATLVESSTSGFTPSGAGASVSMIASRKP
TDGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVSSGKEVSENM
EAEAENQAESQTAEGTVESAATIKSTAC
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggccacagagtctacagccgctgctgccatcgccgcggagctggtttccgctgacaaa
attgaagatgctcctgctccttctacctcggcagataaaatggagagtctggatgtggat
agtgaagctaagaaactactgggattaggacagaaacatctggtgatgggtgacattcca
gcagctgttaatgcattccaggaagcagctagtcttttaggtaagaagtatggagaaacg
gctaatgagtgtggagaagccttctttttttatgggaagtcacttctggagttagccaga
atggagaatggagtgttgggaaatgccttagaaggagtgcatgtagaagaggaagaagga
gaaaaaacagaagatgaatctttggtagaaaataatgataatgtagatgaaactgaaggc
tcagaggaagaggacagagaaaatgacaaggctgaagaaacaccaaatgaatcagttctt
gaaaaaaagtctcttcaagaaaatgaagaggaggagatagggaatttggaacttgcctgg
gatatgctggatttagccaagatcatttttaagaggcaagaaacaaaagaagcccagctt
tatgctgcacaagcccatcttaaacttggagaagttagtgttgaatctgagaattatatc
caagctgtggaggagtttcaggcttgcctaagcctgcaagaacaatatttggaagctcac
gatcgtctccttgcagagactcactaccaattaggtttggcctatggttacaactctcag
tatgatgaagcagtagcacagtttggcaaatctatcgatgtcattgaaaagagaatggct
gtactccatgagcagatgaaggaggccgaaggatcgtttactgaatatgagaaagaaatt
gaggagctgaaagaactgctacctgaaattcgagagaagatagaagacgcaaaggaatct
cagcggagtgggaatgtagccgaactggcactgaaagctactctggtggagagctctact
tccggtttcactcctagtggagctggtgcctcagtatccatgattgccagtagaaaacca
acagatggcgcttcctcatcaaattgtgtgactgatatttcccatcttgtcagaaagaag
aggaaaccagaggaagagagtccccggaaggatgatgcaaagaaagctaaacaagagcca
gaggtgaatggaggcagtggggatgctgtctccagtggaaaggaagtttcagaaaacatg
gaggccgaggctgagaatcaggctgagagccaaacagcagaggggaccgtggagtctgca
gctacaattaaaagcactgcatgttaa

DBGET integrated database retrieval system