KEGG   Mus musculus (house mouse): 50928
Entry
50928             CDS       T01002                                 
Symbol
Klrg1, 2F1-Ag, MAFA, MAFA-L
Name
(RefSeq) killer cell lectin-like receptor subfamily G, member 1
  KO
K10076  killer cell lectin-like receptor subfamily G member 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    50928 (Klrg1)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   50928 (Klrg1)
SSDB
Motif
Pfam: Lectin_C Tweety
Other DBs
NCBI-GeneID: 50928
NCBI-ProteinID: NP_058666
MGI: 1355294
Ensembl: ENSMUSG00000030114
UniProt: O88713
Structure
Position
6:complement(122247555..122259792)
AA seq 188 aa
MADSSIYSTLELPEAPQVQDESRWKLKAVLHRPHLSRFAMVALGLLTVILMSLLMYQRIL
CCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVK
LFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQ
WICKKVLY
NT seq 567 nt   +upstreamnt  +downstreamnt
atggctgacagctctatctattcaacactagagctgccggaggcacctcaagtccaagat
gagtccagatggaagctcaaagctgtcttacaccggccccatctttcccgctttgcaatg
gtggctttggggcttttgactgtgattctcatgagtctactgatgtatcaacggatcctg
tgctgcggctccaaggactctacatgttcccactgccccagctgccccatcctctggacg
aggaatggtagccactgttactatttttcaatggagaaaaaggactggaattctagtctg
aaattctgtgcagacaaaggctcacatctccttacatttccggacaaccagggagtgaag
ctgtttggagagtacctgggtcaggacttttactggatcggcttgaggaacattgatggc
tggaggtgggaaggcggcccagcgctcagcttgaggattcttaccaacagcttgatacag
aggtgcggtgccattcacagaaatggcctccaagcctccagttgtgaagttgctttgcag
tggatctgtaagaaggtcctatactga

DBGET integrated database retrieval system