KEGG   Mus musculus (house mouse): 50933
Entry
50933             CDS       T01002                                 
Symbol
Uchl3
Name
(RefSeq) ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    50933 (Uchl3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50933 (Uchl3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     50933 (Uchl3)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   50933 (Uchl3)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    50933 (Uchl3)
  UBL-specific proteases (ULPs)
   50933 (Uchl3)
SSDB
Motif
Pfam: Peptidase_C12 HpaB
Other DBs
NCBI-GeneID: 50933
NCBI-ProteinID: NP_057932
MGI: 1355274
Ensembl: ENSMUSG00000022111
UniProt: Q9JKB1 Q8BWQ9
Position
14:101891387..101933561
AA seq 230 aa
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt   +upstreamnt  +downstreamnt
atggagggtcaacgctggctgccgctggaggccaaccctgaggtcaccaaccagtttctc
aagcagttaggcctgcatcctaactggcagtttgttgatgtgtacggaatggagcctgaa
cttcttagcatggtaccaagaccagtatgcgcagtgttactcctcttccctatcacagaa
aagtatgaagtcttcagaacagaagaggaagaaaagataaaatctcaaggacaagatgtg
acatcatcagtatattttatgaaacaaaccatcagcaatgcctgtggaacgattggacta
atccatgccattgcgaacaacaaagacaagatgcacttcgaatcagggtcaacattgaaa
aagttcctggaggagtctgtatcaatgagccctgaagagagagccaaattcctggagaac
tatgacgctattcgagttactcatgaaaccagtgcacatgaaggtcagactgaggcacca
agtatagatgaaaaagtagatcttcattttattgcgttagtacatgtagatgggcatctc
tatgaattagatggacggaaaccatttccaattaaccatgggaaaactagtgatgagacg
ttgttagaggatgccatagaagtttgcaagaagttcatggaacgcgaccctgatgagtta
agatttaatgcaattgctctctcagcggcatag

DBGET integrated database retrieval system