KEGG   Mus musculus (mouse): 50934Help
Entry
50934             CDS       T01002                                 

Gene name
Slc7a8, AA408822, LAT2
Definition
(RefSeq) solute carrier family 7 (cationic amino acid transporter, y+ system), member 8
  KO
K13781  solute carrier family 7 (L-type amino acid transporter), member 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    50934 (Slc7a8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    50934 (Slc7a8)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   50934 (Slc7a8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-GeneID: 50934
NCBI-ProteinID: NP_058668
MGI: 1355323
Ensembl: ENSMUSG00000022180
UniProt: Q9QXW9
Position
14; 14 C2
AA seq 531 aa AA seqDB search
MEKGARQRNNTAKNHPGSDTSPEAEASSGGGGVALKKEIGLVSACGIIVGNIIGSGIFVS
PKGVLENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFL
RLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVR
WATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQG
SFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNA
VAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKR
CTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIK
VSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIK
SLTLVSQKMCVVVYPQEGNSGAEETTDDLEEQHKPIFKPTPVKDPDSEEQP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagggagcccgccagcgaaacaacaccgcgaagaaccacccgggttctgacacc
agccctgaggccgaggctagctcgggagggggcggagtagccctgaagaaagagatcgga
ttggtcagcgcctgtggtatcattgtagggaacatcattggctccggaatctttgtctca
ccgaaaggtgtgctggaaaacgcgggctctgtgggccttgctctcattgtctggatcgtg
acaggcatcatcacagccgtgggagctctctgctatgctgagctaggcgtcaccatccct
aagtctggaggtgattactcttatgtgaaggacatcttcggaggactggctgggttcctg
cggctgtggattgctgtgctggtgatctaccccaccaaccaagctgtcatcgccctcacc
ttctccaactacgtgctgcagccgctcttccctacctgcttcccccctgagtccggtctg
cgactcctggctgccatctgtttgttgctcctcacatgggtcaactgctccagtgtccga
tgggccacccgggttcaagatatcttcacagctgggaagctcctggccctggctctgatc
atcatcatgggtattgtgcagatatgcaaaggagaattcttctggctggagccaaagaat
gcatttgagaatttccaagaacctgacatcggcctcgttgctctggcattcctccagggc
tcctttgcctatggtggctggaacttccttaattatgtgactgaggaacttgtggatcct
tacaagaaccttcctagagccatcttcatctccatcccactggtcacatttgtgtacgtc
tttgctaatattgcatacgtcactgcaatgtccccccaggagctgctagcctccaatgca
gttgctgtgacttttggagagaaactcctcggggtcatggcctggatcatgcccatttct
gttgccctgtccacgtttggtggagtcaatggctccctcttcacctcctcccggctgttc
tttgctggagccagagaaggccaccttcccagtgtgttggccatgatccacgtgaagcgc
tgcactccaatcccagccctgctcttcacatgcctctccaccctgctgatgctggtcacc
agtgacatgtacacactcatcaactatgtgggcttcatcaactacctcttctatggggta
acggttgcaggacagatagtccttcgctggaagaagcctgacattccccgccccatcaag
gtcagcctgctgtttcccattatctacctgctgttctgggccttcctgctgatcttcagc
ctgtggtcagagccagtggtgtgtggcattggcctggccattatgctgacaggagttcct
gtctacttcctgggtgtctactggcaacacaaacccaagtgtttcaatgacttcattaag
tccctaaccctagtgagtcagaagatgtgtgtggtcgtgtatccccaggaggggaactcg
ggggctgaggaaacaactgatgacttagaggagcaacacaagcccatcttcaagcctact
cctgtcaaggacccggattcggaggagcagccctga

DBGET integrated database retrieval system