KEGG   Mus musculus (mouse): 50995
Entry
50995             CDS       T01002                                 

Symbol
Uba2, AA986091, Arx, Sae2, UBA1, Ubl1a2, Uble1b
Name
(RefSeq) ubiquitin-like modifier activating enzyme 2
  KO
K10685  ubiquitin-like 1-activating enzyme E1 B [EC:6.2.1.45]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    50995 (Uba2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50995 (Uba2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     50995 (Uba2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   50995 (Uba2)
SSDB
Motif
Pfam: ThiF UBA2_C UAE_UbL UBA_E1_SCCH NAD_binding_7
Other DBs
NCBI-GeneID: 50995
NCBI-ProteinID: NP_057891
MGI: 1858313
Ensembl: ENSMUSG00000052997
Vega: OTTMUSG00000008405
UniProt: Q9Z1F9
Position
7:complement(33840122..33868014)
AA seq 638 aa
MALSRGLPRELAEAVSGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQ
FLFQKKHVGRSKAQVAKESVLQFHPQANIEAHHDSIMNPDYNVEFFRQFILVMNALDNRA
ARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPS
EPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRIST
KEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEANADQQNE
PQLGLKDQQVLDVKSYASLFSKSIETLRVHLAEKGDGAELIWDKDDPPAMDFVTSAANLR
MHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQP
NPRKKLLVPCALDPPNTNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQI
EDGKGTILISSEEGETEANNPKKLSDFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDV
EFEVVGDSPEKVGPKQAEDAAKSIANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSTD
CSGDDKARKRKLEENEAASTKKCRLEQMEDPDDVIALD
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggcactgtcgcgggggttgccccgggagctggccgaggcggtgtccggcggccgggtg
ctggtggttggcgcgggtgggatcggctgtgagctgctcaagaacctggtgctcactggc
ttctcccacatcgacctgattgatctggacactatcgatgtcagcaacctcaacaggcag
ttcttgtttcaaaagaaacatgtgggaagatcaaaggctcaggttgccaaagaaagtgtg
ctccagttccacccccaagccaacattgaggctcaccatgacagcatcatgaacccagac
tataatgtggagttttttcgacagtttatattggtcatgaatgcattagataacagagct
gcacgaaaccacgtgaataggatgtgtctggccgctgatgtgcctctcattgagagcggg
actgctgggtatctcggacaggtgaccactatcaagaagggtgtgactgagtgttacgaa
tgtcaccctaagcctacccagaggacgttccctggctgtacgattcggaacacaccttca
gaacctatccattgcatcgtatgggccaagtatttgttcaaccagctgtttggagaggaa
gatgctgatcaagaagtgtctcctgacagagctgaccctgaggctgcttgggaaccaaca
gaggctgaagctagagctcgagcatctaatgaagacggagacattaagcgtatttccact
aaggaatgggctaagtcaactggatatgatccagttaaactttttaccaagctttttaaa
gatgatattagatatctgctgacaatggacaaactctggcgcaagaggaaacctccagtt
ccactggactgggctgaagtgcagagtcaaggagaagccaatgccgatcaacaaaatgag
ccccagttgggtttgaaagaccagcaggttctggatgtaaagagctatgcgagtctgttt
tcaaagagcatcgagactctgcgagtccatttagcggagaagggggatggagctgagctc
atctgggataaggacgacccacctgcaatggattttgttacatctgctgcaaacctcagg
atgcacattttcagcatgaatatgaagagcaggtttgatataaaatcaatggcagggaat
atcattcctgctatagctactactaatgcagtgatcgccggcttgatagtgttggaagga
ttaaagattttatctggaaaaatagaccagtgtagaactatttttttgaataagcagcca
aacccaagaaagaagctcttggtgccctgtgcactggatcctcccaacaccaactgttac
gtttgtgccagcaagccagaggtgactgtgcggctgaatgtccacaaagtgactgtcctc
accttacaggataagatagtgaaagaaaagtttgctatggtggcaccagatgtccaaatt
gaagatgggaaaggcacaatcctgatatcttcagaagagggagagacagaagccaataac
cccaagaagttgtctgattttggaattagaaacggcagccggcttcaagcagacgacttc
ctccaggactatactttgctgatcaacattcttcatagtgaagatcttggaaaggatgtt
gaatttgaagtagttggtgacagccctgaaaaagtggggccaaaacaagctgaagatgct
gccaaaagcattgccaacggcagcgatgacggtgcccagccttccacctccacagcacaa
gagcaagatgatgtgctcatagttgattcagacgaagaaggcccttcaaatagcaccgac
tgcagcggggacgacaaggcccgcaagcggaagctggaagagaatgaggctgccagtacc
aagaagtgccgcttggagcagatggaagatccagatgacgtcatagcgttagactga

DBGET integrated database retrieval system