KEGG   Mus musculus (mouse): 51792
Entry
51792             CDS       T01002                                 

Gene name
Ppp2r1a, 6330556D22Rik, PP2A, PR65
Definition
(RefSeq) protein phosphatase 2, regulatory subunit A, alpha
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    51792 (Ppp2r1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    51792 (Ppp2r1a)
   04390 Hippo signaling pathway
    51792 (Ppp2r1a)
   04071 Sphingolipid signaling pathway
    51792 (Ppp2r1a)
   04151 PI3K-Akt signaling pathway
    51792 (Ppp2r1a)
   04152 AMPK signaling pathway
    51792 (Ppp2r1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    51792 (Ppp2r1a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51792 (Ppp2r1a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    51792 (Ppp2r1a)
  09156 Nervous system
   04728 Dopaminergic synapse
    51792 (Ppp2r1a)
   04730 Long-term depression
    51792 (Ppp2r1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    51792 (Ppp2r1a)
   05165 Human papillomavirus infection
    51792 (Ppp2r1a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    51792 (Ppp2r1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    51792 (Ppp2r1a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    51792 (Ppp2r1a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    51792 (Ppp2r1a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     51792 (Ppp2r1a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     51792 (Ppp2r1a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     51792 (Ppp2r1a)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 51792
NCBI-ProteinID: NP_058587
MGI: 1926334
Ensembl: ENSMUSG00000007564
Vega: OTTMUSG00000016281
UniProt: Q76MZ3
Structure
PDB: 
3FGA 2PF4 6EF4 2IAE

Position
17; 17 A3.2
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcagctgccgacggtgacgattcgctctatcctattgcggtgctcatagatgaactc
cgcaatgaggacgttcagcttcgtctcaatagtatcaagaagctctccacaattgccttg
gcccttggggttgaacggaccagaagtgagctcctgcccttccttacagataccatttat
gatgaagatgaggtcctcttggccttggctgaacagctgggaaccttcacaactttggtg
ggagggcctgagtatgtgcactgtctgctgccaccccttgagtcactggccacagtggaa
gagacagtagtgcgagacaaggcggtagaatccttgcgggccatctctcatgagcactca
ccttccgatctagaggctcactttgtgcctctggtaaagcggctggcgggtggagactgg
ttcacctcccgcacctcggcctgtggtctcttctcagtttgctacccccgagtatccagt
gccgtgaaggcagaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgctgcctccaagctgggggaatttgccaaggtactggagctggacaat
gtcaagagtgagatcattcccatgttctctaacctggcctctgacgagcaggactcggtg
cggctgctggcagtggaggcatgtgtgaatattgcccagcttctgccacaggaggacctg
gaggccttagtgatgcccaccttgcgacaggctgctgaggacaagtcttggcgtgttcgc
tacatggtggccgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagatctggtgcctgccttccagaacctgatgaaggactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaatctctcagctgactgccgggagaat
gtgatcatgactcagatcttgccctgcatcaaggagcttgtgtcagatgccaaccaacat
gtcaagtcagcactggcttcagtcatcatgggcctctctcccattctgggcaaagacaac
accatcgaacacctcttgcccctgttcttggctcagctgaaggatgagtgtcctgaagtc
cgactgaatatcatctccaacctggattgtgtgaacgaggtgattggcatcaggcagctc
tctcagtccctgcttcctgccatcgtggaactagctgaagatgccaagtggcgagtgcgg
ctggccatcattgaatacatgcctctgctggctggacagcttggtgtggaattttttgat
gagaaactaaactctttgtgtatggcctggctagtggatcatgtctatgctatccgtgag
gctgccaccagcaaccttaagaaattagtagagaagttcgggaaggagtgggcccatgcc
actatcatccccaaggtcttagccatgtctggagaccctaactacctgcaccgaatgact
acactcttctgcatcaatgtgttgtctgaggtctgtggacaggatatcaccaccaagcac
atgctgcccacagttcttcgtatggcaggggacccagttgccaatgtccgcttcaatgtg
gccaagtcactccagaagataggacccattcttgataacagcaccctgcagagtgaagtc
aagcccatcctggagaagctgacccaggaccaggatgtggatgtcaagtactttgcccag
gaggctctgactgttctctctcttgcctga

DBGET integrated database retrieval system