KEGG   Mus musculus (mouse): 51797
Entry
51797             CDS       T01002                                 

Symbol
Ctps, Ctps1
Name
(RefSeq) cytidine 5'-triphosphate synthase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00240  Pyrimidine metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    51797 (Ctps)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     51797 (Ctps)
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA Transket_pyr
Other DBs
NCBI-GeneID: 51797
NCBI-ProteinID: NP_058028
MGI: 1858304
Ensembl: ENSMUSG00000028633
Vega: OTTMUSG00000008810
UniProt: P70698
Position
4:complement(120397065..120427473)
AA seq 591 aa
MKYILVTGGVISGIGKGVIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFV
LDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDA
IQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHV
SLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQ
VICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQSRKMLMKWKEMADRYDRLLETCS
IALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSTDLEPSTLQEEPVRYHEAWQK
LCSAHGVLVPGGFGVRGTEGKIQAIAWARKQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN
STEFDPKTSHPVVIDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDTDYLEERHRH
RFEVNPVLKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPY
FGLLLASVGRLPHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSISQD
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgaagtacattctagttactggtggtgttatatcaggaattggaaaaggagtcatcgcc
agcagtgtgggcacaatacttaaatcatgtggcttacatgtaacatcaattaagattgac
ccctatattaacattgatgcaggaacattctctccttatgaacatggagaagtctttgtg
ctggatgatggtggagaagttgaccttgacttgggaaattatgagcgattccttgatatc
cgtctcaccaaggacaataatctgaccacagggaagatataccagtacgtcattaacaag
gagcgcaaaggggattacttagggaagactgtccaggttgtccctcacatcactgatgca
atccaagagtgggtgatgagacaggcattaatacccgtagacgaagatggcttagaacct
caagtgtgtgttattgagcttggtggcacagtgggagacattgaaagcatgcccttcatt
gaggccttccgccagttccagttcaaggtcaagagggaaaacttttgtaatatccatgtc
agtctggttcctcagccaagttcaacaggggaacagaagacaaaacccacccagaacagt
gttcgggaacttagaggactcgggctttctccagacttagtggtgtgcaggtgctcaaat
cctcttgacacatctgtgaaagagaaaatatcaatgttttgccatgtggaacctgaacaa
gtgatctgtgttcatgatgtttcatccatctaccgggtacccttgttgttagaagagcaa
ggggttgtagactactttcttcggagacttgaccttcctattgagagacagtcacgaaag
atgctgatgaaatggaaagagatggcagacaggtatgaccgcttgctggagacctgctcg
atcgctcttgtgggcaaatacaccaaattctcagactcgtacgcctctgtcattaaagcg
ctagagcactctgcattggccattaaccacaagctggagatcaagtacatcgattccaca
gacctggagccaagtaccctgcaggaagagcctgtgcgctaccatgaggcatggcagaag
ctctgcagtgctcatggagtgctggttccaggaggatttggtgttcggggaacagaagga
aaaattcaagcaattgcttgggctcggaaacagaagaagccttttttgggtgtgtgctta
ggaatgcagctagcagtggtagaattttcaagaaatgtgctgggatggcaagatgccaat
tctacagagtttgaccccaagactagtcaccctgtggttatagacatgccagaacataac
cctgggcaaatgggtggaaccatgaggctgggcaagaggagaaccctgttccagaccaag
aactcagtcatgaggaaactctatggagacacagactacttggaagaaaggcaccgccac
cgatttgaggtgaacccagtcctgaaaaagtgcttggaagagcaaggcttgaagttcgtt
ggccaagatgtggaaggcgagaggatggagatcgtggagttggaagatcatccatttttt
gttggagtgcagtatcaccccgagttcctgtccaggcctatcaagccctccccaccctac
tttggcctcctcctggcctctgtggggcggctcccacattaccttcagaaaggttgccgg
ctctcacccagggacacttacagtgacagaagcgggagcagctcccccgactcggaaatc
actgaactcaagtttccatcaataagtcaggactga

DBGET integrated database retrieval system