KEGG   Mus musculus (mouse): 51798
Entry
51798             CDS       T01002                                 

Gene name
Ech1, AA617331
Definition
(RefSeq) enoyl coenzyme A hydratase 1, peroxisomal
  KO
K12663  Delta3,5-Delta2,4-dienoyl-CoA isomerase [EC:5.3.3.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    51798 (Ech1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.21  Delta3,5-Delta2,4-dienoyl-CoA isomerase
     51798 (Ech1)
SSDB
Motif
Pfam: ECH_1 ECH_2 Transglut_i_TM
Other DBs
NCBI-GeneID: 51798
NCBI-ProteinID: NP_058052
MGI: 1858208
Ensembl: ENSMUSG00000053898
Vega: OTTMUSG00000031167
UniProt: O35459
Position
7; 7 B1
AA seq 327 aa
MATAMTVSSKLRGLLMQQLRGTSQLYFNISLRSLSSSAQEASKRAPEEVSDHNYESIQVT
SAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLM
DMASELMQPSGDDAARIAWYLRDLISKYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLVSA
CDIRYCTQDAFFQIKEVDMGLAADVGTLQRLPKVIGNQSLVNELTFSARKMMADEALDSG
LVSRVFQDKDAMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSM
LQTQDIIKSVQAAMEKRDTKSITFSKL
NT seq 984 nt   +upstreamnt  +downstreamnt
atggctaccgcgatgacagtttccagtaaactccgcggcctgctgatgcagcagctgaga
ggtaccagccagctgtacttcaacatcagccttcgatctctgagctcctctgcacaagag
gcctccaagagagcccccgaggaagtctcagaccacaactatgagtctattcaagtcaca
agtgcccagaagcatgttctccacgtgcagctaaaccggccagagaagaggaatgccatg
aacagggctttctggagggagttggtggaatgcttccaaaagatatccaaagactcggac
tgccgggctgttgtagtctccggtgcaggaaagatgttcacttcaggtattgacctcatg
gacatggcctccgaactcatgcagccctcaggagatgatgcggcccgcatagcctggtac
ctccgtgacctcatcagcaagtaccagaagaccttcactgtcattgagaagtgccccaag
ccagtgattgctgccattcacggaggctgcattggcggaggtgtggacctcgtttctgcc
tgtgacattcgctactgcactcaggatgcttttttccagatcaaggaggtagatatgggc
ttggctgctgatgtaggaacactgcagagactgcccaaggtcatcgggaaccagagcctg
gtcaacgagctgaccttctctgcccgcaagatgatggctgacgaggccctggacagtggg
ctggtcagccgcgtgttccaagataaggacgccatgctgaatgcagcctttgccctggcg
gctgatatttccagcaagagccctgtggctgtgcaggggtcaaaaatcaatctcatctac
tcccgagaccattctgtggacgagagccttgactacatggccacctggaacatgagcatg
ctgcagacccaggacatcatcaaatcagtccaggcagccatggagaagagggacacaaaa
agcatcaccttctccaagctctga

DBGET integrated database retrieval system