KEGG   Mus musculus (mouse): 51800
Entry
51800             CDS       T01002                                 

Gene name
Bok, matador, mtd
Definition
(RefSeq) BCL2-related ovarian killer
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    51800 (Bok)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 51800
NCBI-ProteinID: NP_058058
MGI: 1858494
Ensembl: ENSMUSG00000026278
Vega: OTTMUSG00000048660
UniProt: O35425 Q3TH93
Position
1; 1 D
AA seq 213 aa
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERASPAP
GGRLAEVCTVLLRLGDELEQIRPSVYRNVARQLHIPLQSEPVVTDAFLAVAGHIFSAGIT
WGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVV
STDPGFRSHWLVATLCSFGRFLKAAFFLLLPER
NT seq 642 nt   +upstreamnt  +downstreamnt
atggaggtgctgcggcgctcttctgtctttgcagcggagatcatggacgcctttgatcgc
tcgcccacagacaaggagctggtggcccaggctaaggcactaggccgggagtacgtgcac
gcgcggcttttgcgcgccggcctctcctggagcgctccagagcgtgcctcgcctgcccct
ggaggacgcttggcagaggtgtgcacagtgctgctgcgcttgggagatgagctggagcag
atccgtcccagcgtataccggaacgtggcccggcagctgcacatccccctgcagtcggag
cctgtggtgacggatgccttcctggcagtggcaggccacatcttctcagcaggtatcaca
tggggcaaggtagtgtccctgtattccgtggccgcggggctagcggtggactgtgtccgg
caggctcagcctgccatggttcatgccctggttgactgcctgggggagtttgtacgcaag
accttggctacctggcttcggaggcgtggtggatggacggatgtcctcaagtgtgtggtc
agcacagatcctggcttccgctcccactggctcgtggccacgctctgcagctttggccgc
ttcctgaaggcagcattcttcctgttgttgccagagagatga

DBGET integrated database retrieval system