KEGG   Mus musculus (house mouse): 51811
Entry
51811             CDS       T01002                                 
Symbol
Clec4f, Clecsf13, KUCR_MOUSE, Kclr
Name
(RefSeq) C-type lectin domain family 4, member f
  KO
K10060  C-type lectin domain family 4 member F
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    51811 (Clec4f)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Largerin and kupffer cell receptors
    51811 (Clec4f)
SSDB
Motif
Pfam: Lectin_C Crescentin Fez1 Phage_GP20 TPR_MLP1_2 MscS_porin WEMBL CC149 HMMR_N GAS NPV_P10 DUF1664 DASH_Duo1 DUF4407 OmpH RPW8 DUF4200 IFT57 Filament LPP Tropomyosin_1 CC2-LZ DUF4201 CENP-F_leu_zip Tektin DUF2730 CHGN DUF641 Comm FH2 FPP AIP3 SKA1 DUF5798 Med9 CALCOCO1
Other DBs
NCBI-GeneID: 51811
NCBI-ProteinID: NP_058031
MGI: 1859834
Ensembl: ENSMUSG00000014542
UniProt: P70194 A0A0R4IZZ5
Structure
Position
6:complement(83621524..83633098)
AA seq 548 aa
MKEAELNRDMARYCTDNQCVSLQPQGLGPKSAALMAPRTLRHVQVILALMVVTVIFSLLA
LFVVASQPWRPEWNKEPPSLLLRGSNNSGHDNHSQFVRETEMQVAIQRLRDYEENSSSCH
KEVQILKYQMDNVSSLVQLLGSHLEDVNADILQTKDVLKESGALALETQALRSSLEVASA
DIHSLRGDLEKANAMTSQTRGLLKSSTENTSAELHVLGRGLEEAQSEIQALRGSLQSAND
LSSQTQGFLQHSMDNISAQIQTVRDGMERAGEKMNSLKKELETLTAQTQKANGHLEQTDA
QIQGLKAELKSTSSLNSRIEVVNGQMKDASRELQTLRRDLSDVSALKSNVQMLQSNLQRA
KTEMQSLKADLQATKALTAKIQGEQNRLGALQEAVAAQKQEQKTQNQVLQLIAQNWKYFN
GNFYYFSRDKKPWREAEKFCTSQGAHLASVTSQEEQAFLVQTTSSGDHWIGLTDQGTEGI
WRWVDGTPFNNAQSKGFWGKNQPDNWRHRNGEREDCVHVRQQWNDMACGSSYPWVCKKST
GWSAARVG
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgaaggaggccgagctgaacagagatatggctagatattgcacagacaaccagtgtgtc
tccctacagccccaaggactggggcctaagtcagctgctctcatggctcccaggaccctg
cggcacgtccaggtcattctggcattaatggtggtgactgtgatcttttctctccttgct
ctttttgtggtggcttcacagccttggagacctgagtggaataaagagcctccctccctc
ctgcttcggggaagcaacaactctggacacgacaatcattcccaatttgtcagggagaca
gaaatgcaagtggctatccagaggcttagggactatgaggagaattctagcagctgtcac
aaggaggtacagatactgaagtaccaaatggacaatgttagttctctggtgcagttgctt
gggagccatctagaggatgtgaatgctgacatcctgcagacaaaagatgtgctgaaggaa
tctggagccttggctttggagacccaggcgctgagaagctccttggaggtggccagtgct
gatatccatagtctgagaggagatttggaaaaggcaaacgctatgacttcccagacccga
ggtctcttaaagagcagcacagaaaacaccagtgctgagctccacgtgctgggcagaggc
ctggaggaagcccagtctgagatccaggcgttgaggggaagtctgcagagtgcaaatgac
ctcagctcccagacccagggctttctccagcacagtatggacaacattagtgctcagatc
cagaccgtgagagatggtatggaaagggctggtgaaaagatgaactcgttaaagaaagag
ctggaaacactcactgctcagactcaaaaggcaaatggccacctggagcagacagatgcc
cagatccagggcttaaaagctgagctgaaaagcaccagttccttgaactcccggattgag
gtggtcaatggccaaatgaaagatgccagcagagagttacagaccctgagaagggacctg
agtgatgtctcagctttgaagtccaatgtccagatgctacagagcaatcttcagagggcc
aagacagagatgcagagtttgaaggcagatctgcaggcgaccaaagccctcactgccaag
attcagggggagcagaatcgcctgggggccctgcaggaagctgtggctgcacagaagcag
gagcagaagactcagaatcaggttctccagctgatcgcgcagaactggaagtacttcaat
ggaaacttttattacttttctcgtgacaagaagccgtggcgggaggctgagaagttctgt
acgtcccagggagcgcacctggcttcggtgacctctcaggaggaacaggcattcctggta
cagactacaagttctggggaccattggattgggctcactgaccagggcacagagggcatc
tggcgctgggtagatgggacaccattcaacaatgcccagagcaaagggttttgggggaaa
aatcagcctgacaactggagacataggaacggagagcgagaagactgtgttcacgtccgg
cagcagtggaacgacatggcctgtggatcctcctacccctgggtgtgcaagaagtccaca
gggtggtctgcggccagagtaggctag

DBGET integrated database retrieval system