KEGG   Mus musculus (mouse): 51813Help
Entry
51813             CDS       T01002                                 

Gene name
Ccnc, AI451004, AU020987, CG1C
Definition
(RefSeq) cyclin C
  KO
K15161  cyclin-C
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    51813 (Ccnc)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     51813 (Ccnc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C_2 TFIIB Cyclin_C
Motif
Other DBs
NCBI-GeneID: 51813
NCBI-ProteinID: NP_058026
MGI: 1858199
Ensembl: ENSMUSG00000028252
Vega: OTTMUSG00000004717
UniProt: Q62447 Q8CAS3
Position
4; 4 A3
AA seq 283 aa AA seqDB search
MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQ
VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAATTSVLKTRF
SYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDVLLPLAWRIV
NDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQ
WKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaacttctggcagagctcccactatttgcagtggattttggataaacaagat
ctgttgaaagagcgccaaaaggacctaaagtttctctcagaagaggagtattggaagtta
caaatattttttacaaatgttatccaagcattaggtgaacatcttaaattaagacaacaa
gttattgctactgctacagtctatttcaagagattctatgctaggtattctctgaaaagt
atagatcctgtattaatggcgcctacatgtgtgtttctggcatccaaagtagaggaattt
ggtgttgtctcaaatacaagattgattgctgctactacttctgtattaaaaactagattt
tcatatgcttttccaaaggaatttccttacaggatgaatcatatactagaatgtgaattt
tacctcttagaattaatggactgttgcttgatagtgtatcatccttatagacctttgctc
cagtatgtgcaggacatgggccaggaagacgtgctgcttccccttgcatggaggatagtg
aatgatacctacaggacggatctctgtctgctgtaccctccgttcatgatcgctttagct
tgcctacatgtagcctgtgtcgtacaacagaaagatgctagacagtggtttgcagaactt
tctgtggatatggagaagattttggaaataatcagggttattttaaaactgtatgagcag
tggaagaattttgatgagagaaaagagatggcaactattcttagtaagatgccgaaacca
aaaccacctccaaacagtgaaggtgagcagggtccaaatggaagtcagaactctagctac
agccaatcttaa

DBGET integrated database retrieval system