KEGG   Mus musculus (mouse): 51897
Entry
51897             CDS       T01002                                 

Gene name
Atg13, 1110053A20Rik, D2Ertd391, D2Ertd391e, Harbi1
Definition
(RefSeq) autophagy related 13
  KO
K08331  autophagy-related protein 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04211  Longevity regulating pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    51897 (Atg13)
   04136 Autophagy - other
    51897 (Atg13)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    51897 (Atg13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    51897 (Atg13)
   05014 Amyotrophic lateral sclerosis
    51897 (Atg13)
   05016 Huntington disease
    51897 (Atg13)
   05017 Spinocerebellar ataxia
    51897 (Atg13)
   05022 Pathways of neurodegeneration - multiple diseases
    51897 (Atg13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    51897 (Atg13)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    51897 (Atg13)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    51897 (Atg13)
   Atg1 complex
    51897 (Atg13)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    51897 (Atg13)
SSDB
Motif
Pfam: ATG13
Other DBs
NCBI-GeneID: 51897
NCBI-ProteinID: NP_663503
MGI: 1196429
Ensembl: ENSMUSG00000027244
Vega: OTTMUSG00000014308
UniProt: Q91YI1
Position
2; 2 E1
AA seq 479 aa
METELSSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPE
VTHEAKKALSGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNR
LSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLNGLGEGFQTVRVGTVGTPV
GTLTLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAEDAGVA
YPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVTLAPSHPTHGAQADPERLVMHMPSDGTH
CAATPSSSEDTETVSNSSEGRASPHDILETIFVRKVGAFVNKPINQVTVTSLDIPFAMFA
PKNLELEDADPMVNPPESPETTSPLHGSLHSDGSSGGSGGSTHDDFVMIDFKPAFSKDDI
LPMDLGTFYREFQNPPQLSSLSIDFGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggaaactgaactcagctcccaggacaggaaggacttggacaagtttattaagtttttt
gccctcaagactgtccaagtgattgtccaggctcgacttggagaaaagatttgcacccgc
tcatcatcttccccgacgggttcagattggttcaatttagcaatcaaagacatcccagaa
gtcacccatgaagcaaagaaggccctgtcagggcagctgcctgctgtggggcgatctatg
tgtgtggaaatctcactcaagacttctgagggagattctatggagttggaaatttggtgt
cttgaaatgaatgaaaagtgtgacaaagaaatcaaagtttcctacactgtatacaaccga
ttgtcactgctgctgaagtctcttctcgctattacaagggtgacaccagcctatcgactc
tccaggaagcaagggcatgaatatgtaattttgtacaggatttattttggggaagttcaa
ctgaatggcttaggagaaggcttccagacagttcgagttggaacagtgggcacccctgtg
ggcaccctcactctttcctgtgcttatagaattaacttggcattcatgtccaccaggcaa
tttgagaggaccccacctatcatggggattatcattgatcactttgttgaccgtccctat
cccagctcttctcctatgcacccctgtaattacagaactgctgaggacgcaggggtcgcg
tacccgtcagtggaagactctcaggaagtgtgtaccacatctttttccacatcccctccc
tcccagctgatggttcctgggaaggaaggcggggtaactcttgctcccagccaccccact
catggtgcccaggctgatcccgagagactggtgatgcacatgccttctgatgggacccat
tgtgccgccacgccctcaagcagtgaggacactgagactgtgtctaacagcagtgaagga
cgggcctcaccccatgacatcttggagactatctttgtccgaaaagtgggagcatttgtc
aacaaacccatcaatcaggtgactgtgacgagtttggacatacctttcgccatgtttgct
cccaagaatttggagctggaggatgctgatcctatggtgaatcccccggagtccccagag
accacatctcccctccatggcagcctgcactcagatggctccagcgggggcagcgggggc
agcacacatgacgactttgttatgattgactttaaaccagctttttctaaagacgacatt
cttccaatggacttggggaccttctaccgtgaatttcagaacccccctcagctgagcagc
ctctccatagattttggagctcagtctatggcggaagatttggactccttaccagagaag
ctggctgtgcatgagaagaatgtccgagaattcgatgcctttgtggaaaccctgcagtaa

DBGET integrated database retrieval system