KEGG   Mus musculus (mouse): 51902Help
Entry
51902             CDS       T01002                                 

Gene name
Rnf24, 2810473M14Rik, 4930505A13Rik, AI317164, C86507, D2Ertd504e
Definition
(RefSeq) ring finger protein 24
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_2 zf-RING_11 zf-rbx1 zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-C3HC4_3 zf-RING_UBOX zf-ANAPC11 Prok-RING_1 Prok-RING_4 zf-RING_4 zf-TFIIIC Orthoreo_P10 Zn_ribbon_17 zf-C3H2C3 RINGv
Motif
Other DBs
NCBI-GeneID: 51902
NCBI-ProteinID: NP_848722
MGI: 1261771
Ensembl: ENSMUSG00000048911
Vega: OTTMUSG00000016039
UniProt: Q8BGI1 Q4VA59
Position
2 F1; 2 63.32 cM
AA seq 148 aa AA seqDB search
MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAVFVFILSLLFCCYLIRLRHQAHKEFYAY
KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLVKWLEVRKVCPLCNM
PVLQLAQLHSKQDRGPPQEPLPGAENIV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagatttcccacattataacttcaggatgcctaatattggattccagaatctg
cctctcaacatctatatcgtggtttttggcactgctgtgtttgtcttcatccttagttta
ctcttctgttgctacttgattaggctgagacatcaagcacacaaagaattttatgcctac
aaacaggttatattaaaagaaaaagtaaaagaacttaatctacatgagctctgtgctgtg
tgtctagaagacttcaagcctagagatgaactgggtatttgcccatgtaagcatgccttc
cacagaaagtgccttgttaagtggctggaagtccggaaagtgtgtcccctgtgcaacatg
ccggtgctgcagctggcccaattgcacagtaaacaggaccgcggtccccctcaggagccc
ctccctggggcagagaatattgtatag

DBGET integrated database retrieval system