KEGG   Mus musculus (house mouse): 51960
Entry
51960             CDS       T01002                                 
Symbol
Kctd18, 4932411A20Rik, 6530404F10Rik
Name
(RefSeq) potassium channel tetramerisation domain containing 18
  KO
K21921  BTB/POZ domain-containing protein KCTD18
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    51960 (Kctd18)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     51960 (Kctd18)
SSDB
Motif
Pfam: KCTD18_C BTB_2 BTB_3 Ashwin
Other DBs
NCBI-GeneID: 51960
NCBI-ProteinID: NP_001153336
MGI: 3603813
Ensembl: ENSMUSG00000054770
UniProt: E0CZ26
Position
1:complement(57994260..58009298)
AA seq 429 aa
MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFKDSMLASMFSGRFPLK
TDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEADYFGIPYPYSLSDHLAN
EMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKTDG
TDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMMDAFDAWEGKGVSYWRVPH
ELIECWTLEERPLHGSLRHMAPIRKRRLIALREEDEGVNCKTGPKPVRFLGPSTSTQIKV
KNSASVRVSPANAAQISSQATANRSHRGSCGKAAQCSVATGASGHAPASPDAQSSENQAT
HPPPAKVLLSEKKSPPPRVIKLRRTPLRGGPSLPTASAGGQACFPQPPSLEASSSLGVQM
ETRKDQPDG
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcttaaggcagaacttcaggcatcgaagggagcaatggcaggccatgaagcagaagac
gtgctagatatccttcggctgaatgtgggtggctgcatctacacagcccggcgagagtct
ttgtgccgctttaaggattctatgctggcatctatgtttagtggtcgtttccctctaaaa
acagatgaatctggggcgtgcattattaaccgtgatggacatctattcaaatacattttg
gactacctgcacggggaggtgcagaccccctcggatgagcagacgcgagctgccctgcag
gaggaggctgactactttggcatcccttacccgtacagcttgtctgaccacttggccaat
gagatggagacatattctttaaggtcaaatatagaacttaaaaaggctttaacagacttc
tgtgattcctatggcttagtttgcaataaaccaacagtttgggttctccactatcttaac
acatctggtgcaagctgtgagagtagaattattggtgtctatgctacaaaaactgacggg
acagatgccattgataagcagctgggaggaaggattcatagtaaaagcattttcaaaaga
gaggcggggaacaacgttcagtacatttggagctattactcagtagccgagttgaagaaa
atgatggatgcctttgatgcttgggaaggaaaaggggtaagctactggcgtgtgcctcat
gagctgatagagtgttggactttggaagaacggcctttacacggaagcctgcgtcatatg
gccccaattcgaaagaggcggctgatagccctcagggaagaggatgaaggtgtgaactgt
aagactggtcctaagccagtcagatttttgggcccttctacaagtacccaaattaaagtc
aagaactctgcttcagtgagggtgtcacctgccaatgctgcccagatctcctctcaggct
acagcaaaccgctctcacagaggcagctgtggaaaggcagcccagtgctctgtggccaca
ggggcttctgggcatgctcccgcttcccccgatgcccagagctctgaaaaccaagccaca
cacccacctccagccaaggtgctcctctctgaaaagaagtctccaccccctcgagtgatc
aagctgaggaggactccactgcgtggggggccttccctgcccaccgcctcagcagggggc
caggcctgcttcccccagccaccctctctagaagcttccagcagtttgggtgtgcagatg
gagaccaggaaagaccagcctgatgggtaa

DBGET integrated database retrieval system