KEGG   Mus musculus (mouse): 52009
Entry
52009             CDS       T01002                                 

Gene name
Jpt2, 2810430B18Rik, AL022629, C16orf34, D17Ertd441, D17Ertd441e, Hn, Hn1l
Definition
(RefSeq) Jupiter microtubule associated homolog 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: JUPITER
Other DBs
NCBI-GeneID: 52009
NCBI-ProteinID: NP_945175
MGI: 1196260
Ensembl: ENSMUSG00000024165
UniProt: Q6PGH2 Q3TM10
Position
17 A3.3; 17 12.53 cM
AA seq 190 aa
MFQGADSQAGKSGSRSMKPPGGESSDLFGSPEEGISSSKPNRMASNIFGPTEEPKNIPKR
TNPPGGKGSGIFDESTPVQTRQRLNPPGGKTSDIFGSPVTATAPLAHPNKPKDHVLLCEG
EDSKSDLKAATDSTPRGEQSDKGSSKEVEHAKIPEPTPTVDSHEPRLGPRPRSHNKVLNP
PGGKSSLSFY
NT seq 573 nt   +upstreamnt  +downstreamnt
atgttccagggcgcggacagccaagctggcaagtcgggttccaggtccatgaagcccccg
ggaggagaatcgagcgatcttttcggaagtccagaagaaggtatttcttcaagcaagcct
aataggatggcatctaatattttcggaccaactgaagaacctaaaaacatacccaagagg
acaaatcctccaggaggcaaaggaagtgggatctttgatgaatcgactcctgtgcaaact
cgacaacgtttgaatccaccaggggggaagaccagtgacatatttgggtccccagtcact
gccactgcgcctctggcacacccaaacaagcccaaggatcatgttttgctgtgtgaaggt
gaagactctaagtctgacctgaaagctgcaacagactccacacccagaggagagcagagt
gacaaaggaagctcaaaagaagtagagcatgcaaagataccggagcccacacctacagtt
gacagtcatgaacccagactggggccacgacctcgctcccacaacaaagtcctgaaccca
ccaggaggcaaatccagcctctccttctattga

DBGET integrated database retrieval system