KEGG   Mus musculus (mouse): 52024Help
Entry
52024             CDS       T01002                                 

Gene name
Ankrd22, 5430429D21Rik, D19Ertd675e
Definition
(RefSeq) ankyrin repeat domain 22
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 UPF0542
Motif
Other DBs
NCBI-GeneID: 52024
NCBI-ProteinID: NP_077166
MGI: 1277101
Ensembl: ENSMUSG00000024774
Vega: OTTMUSG00000034904
UniProt: Q9D3J5
Position
19 C1; 19 29.33 cM
AA seq 191 aa AA seqDB search
MGILYSEPICQAAYQNDLGQVWRWAKESNHYVDVQDSFNGDTPLICACRRGHLRIVSFLL
RRNADVNLKNLKERTCLHYAVKKRFTFFDYLLIILLMPVLLIGYFLMVSKTKQNETLVRM
LLNAGVEVNATDCDGYTALHYACQMKNQTLIPLLLEAHADPMIKNKHGESSLDIAQRLKF
SQIALMLKRAS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctatattctgagcccatctgccaggcagcctaccagaacgacttggggcaa
gtgtggcggtgggcaaaagaaagcaaccattatgtggatgttcaagatagcttcaatggc
gatactcccctcatctgtgcctgcaggcggggccacctgagaattgtctccttcctttta
aggagaaatgctgatgtcaacctcaaaaacttgaaggagagaacctgcttgcactatgct
gtgaagaagagatttaccttctttgattatctactcattatccttttaatgcctgtcttg
ctaattggatatttcctcatggtatcaaagacaaagcagaatgagactcttgtccggatg
ctccttaatgctggcgtagaagttaatgctactgactgcgacggctacactgccctgcac
tatgcttgccagatgaaaaaccagactctcatccctctgcttctggaagcccatgcagac
cccatgataaagaacaagcatggtgagagttcactggatatcgcacagagactaaaattt
tcccagattgcactaatgctaaagagagcctcctag

DBGET integrated database retrieval system