KEGG   Mus musculus (mouse): 52036Help
Entry
52036             CDS       T01002                                 

Gene name
Ppp6r3, 4930528G08Rik, 9130026N02Rik, D19Bwg1430e, D19Ertd703e, Pp6r3, Ppcs3, Pptcs3, Sapl, Saps3, mKIAA1558
Definition
(RefSeq) protein phosphatase 6, regulatory subunit 3
  KO
K15501  serine/threonine-protein phosphatase 6 regulatory subunit 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    52036 (Ppp6r3)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    52036 (Ppp6r3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-6
    Regulatory subunits
     52036 (Ppp6r3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Protein phosphatase 6
     52036 (Ppp6r3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAPS DUF1572
Motif
Other DBs
NCBI-GeneID: 52036
NCBI-ProteinID: NP_083732
MGI: 1921807
Ensembl: ENSMUSG00000024908
UniProt: Q922D4
Position
19 A; 19 3.21 cM
AA seq 844 aa AA seqDB search
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSF
IIEEPPQDMDEKIRYKYPNISCELLTSDVSQMNDRLGEDESLLMKLYSFLLNESPLNPLL
ASFFSKVLSILISRKPEQIVDFLKKKRDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEERIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQVQNSTEPDPLLA
TLEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLETRRPTFEGHIEICPPGMSHSACS
VNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGILDPPVGNTRLNVIRLISSLLQTNTS
SINGDLMELNSIGVILDMFFKYTWNNFLHTQVEICIALILASPFENAENGTITDQDSTGD
NLLLKHLFQKCQLIERILEAWDTNEKKQAEGGRRHGYMGHLTRIANCIVHSTDKGPNSAL
VQQLIKDLPDEVRERWETFCTNSLGETNKRNTVDLAFSDYQMQQMTSNFIDQFGFNDEKF
ADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIA
FTPESQRRSSSGSTDSEESTDSEEEDGAKQDLFESSSANTEDKMEVDLNEPPTWSANFDV
PMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKESLRSNSPVEMETSTE
SVDPLTPGAAALATQPEAPGSMAMEASSDGEEDAESTDKVTETVMNGGMKETLSLTVDAK
TETAVFKSEEEKLSTSQDAACKDAEETPEPAEAKCTAPLTPSSSPEQRTDQPSMPSDPSV
NGPV
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgttttggaaatttgatcttcactcatcatcccacatagacacgcttctagagagagaa
gatgtgacactgaaggagctaatggatgaggaggatgttctacaggagtgtaaagcacag
aaccgcaagctcatagaatttctgttaaaagcagaatgtctggaagatttagtctcattc
attatagaagaaccacctcaagatatggatgagaagatccgatacaagtatccaaatata
tcttgtgagttgctcacatctgatgtctcccagatgaatgatagactgggggaagatgag
tccttgctaatgaaattgtatagcttcctcctaaatgagtcccccttgaacccactactc
gccagtttcttcagcaaggtgctaagtattcttatcagcagaaaaccagaacagattgtg
gatttcttgaaaaagaagcgtgattttgtggatctcattataaagcacataggaacttct
gctatcatggatttattgctcaggctcttgacatgtattgagcctccacaacccaggcaa
gatgttctgaattggctaaatgaggagaggattatccagaggcttgtggaaatagttcac
ccatcgcaagaagaagatcggcattcaaatgcctcacaatcactttgtgaaattgttcgc
ctgagcagagaccagatgttacaagttcagaacagtacagagccagaccccctgcttgcc
actctagaaaagcaagaaattattgagcagcttctgtcaaatatttttcacaaggagaag
aatgaatcggccatagtcagtgcaattcagattttgctgactttgcttgagactcgacgg
ccaacgtttgaaggccatatagaaatctgccccccgggcatgagtcattcagcttgttca
gttaacaagagtgttcttgaagccatccgaggaagacttggatctttccatgaactccta
ctcgagccacccaagaaaagtgtgatgaagactacatggggtatattggacccacctgtg
gggaatactcgattaaatgtcattaggttgatatccagcctgctccaaaccaataccagc
agcataaatggagacctgatggaactgaacagcattggcgtcatattggatatgttcttc
aagtacacatggaataactttctacacacgcaagtggaaatttgcattgctctcattctg
gccagtccttttgagaatgcagagaatggcacaattactgatcaagactccactggtgac
aatttgttattgaagcatctttttcaaaagtgtcagttaatagagcgaatacttgaagcc
tgggacacaaatgagaagaaacaggctgaaggaggacgacggcatggttacatgggacac
cttacgaggatagctaactgtattgtgcacagcactgacaagggtccgaacagtgcgtta
gtacagcagctcatcaaagatcttcccgatgaagtcagggagcggtgggagacgttctgc
acgaactccttaggagagacgaacaagaggaacacggtagatctagccttttctgattat
cagatgcaacaaatgacgtccaattttattgaccagtttggcttcaacgatgagaagttt
gcagaccaagacgacattggcaatgtttcttttgatcgggtgtcagatatcaactttact
ctcaatacaaatgaaagtggaaatattgccctgtttgaagcatgttgtaaagaacggata
caacaatttgatgatggcggctctgatgaagaggatatctgggaggagaagcacattgca
tttactcccgaatcccagaggaggtccagctctggcagtacggacagtgaagaaagtaca
gactctgaagaagaagatggggccaaacaagacctgtttgagtccagcagtgcaaacaca
gaggacaaaatggaggtggatctgaatgagccacccacctggtcagccaactttgacgtc
ccaatggaaaccacccatggtgctcccttagactccgtgggatccgatgtctggagcaca
gaggagccaatgccaactaaagagacaggctgggcttccttttcagagttcacatcctcc
ctgagcacaaaggagtctttaaggagtaattcgcctgtggaaatggaaaccagcactgaa
tccgtggaccccttgacacctggtgcagctgccttggccactcagccagaggcaccaggc
agtatggccatggaagccagctcagatggggaagaggatgctgagagtacagacaaggta
actgagaccgtgatgaatggcggcatgaaggaaacactcagcctcactgtagacgccaag
acagagactgcagtcttcaaaagtgaggaagaaaaactgtctacctctcaagatgctgct
tgcaaagatgcagaagagaccccagagccagcagaggccaagtgcacagctcccctgact
cccagcagtagtcccgagcaaaggaccgaccagccaagcatgccaagcgacccatcagtt
aatggccctgtatga

DBGET integrated database retrieval system