KEGG   Mus musculus (house mouse): 52055
Entry
52055             CDS       T01002                                 
Symbol
Rab11fip5, 9130206P09Rik, C75969, D6Ertd32e, GAF1, RIP11
Name
(RefSeq) RAB11 family interacting protein 5 (class I)
  KO
K12484  Rab11 family-interacting protein 1/2/5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    52055 (Rab11fip5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    52055 (Rab11fip5)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    52055 (Rab11fip5)
SSDB
Motif
Pfam: C2 RBD-FIP
Other DBs
NCBI-GeneID: 52055
NCBI-ProteinID: NP_803417
MGI: 1098586
Ensembl: ENSMUSG00000051343
UniProt: Q8R361 Q6ZQ33
Position
6:complement(85311944..85351663)
AA seq 645 aa
MALVRDPEPAAGSSRWLPTHVQVTVLRASGLRGKSSGAGSTSDAYTVIQVGREKYSTSVV
EKTQGCPEWCEECSFELPPGALDGLLRAQEADAGPAPWASGPNAACELVLTTMHRSLIGV
DKFLGRATVALDEVFRAGRAQHTQWYRLHSKPGKKEKERGEIQVTIQFTRNNLSASMFDL
SMKDKPRSPFSKLKDRVKGKKKYDLESASAILPSSALEDPELGSLGKMGKAKGFFLRNKL
RKSSLTQSNTSLGSDSTLSSTSGSLVYQGPGAELLTRSPSHSSWLSTEGGRDSIQSPKLL
THKRTYSDEASQLRAAPPRALLELQGHLDGASRSSLCVNGSHVYNEEPQPPLRHRSSISG
PFPPSSSLHSVPPRSSEEGSRSSDDSWGRGSHGTSSSEAVPGQEELSKQAKGASCSGEEE
GARLPEGKPVQVATPMVASSEAVAAEKDRKPRMGLFHHHHHQGLSRSEQGRRGSVGEKGS
PSLGASPHHSSTGEEKAKSSWFGLRESKEPTQKPSPHPVKPLTAAPVEASPDRKQPRTSL
STALSSGLERLKTVTSGGIQSVLPASQLGSSVDTKRPKDSAVLDQSAKYYHLTHDELIGL
LLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQISPGPPK
NT seq 1938 nt   +upstreamnt  +downstreamnt
atggctctggtgcgggaccctgagccggcggccggatcctcccgctggctgcccacgcat
gtccaggtgaccgtgctgcgggccagcgggttgaggggcaagagctcgggcgccggcagc
accagcgacgcgtacacggtgatccaggtgggccgagagaagtacagcacctcggtagtg
gagaagacgcaaggctgcccggaatggtgcgaagagtgttcgttcgagctaccgcctgga
gccctggacggcctgctgcgggcacaggaggcagatgcgggccctgcgccctgggcctcc
ggccccaacgccgcctgcgagctcgtgctcaccaccatgcatcgctcactcatcggcgtg
gacaagtttctgggccgggcaaccgtagctctggacgaggtcttccgcgcaggccgcgcc
cagcacacgcagtggtacaggcttcactccaagccaggcaagaaggagaaggagcgcggt
gagatccaggtgaccatccagttcacacggaacaacctgagcgccagcatgtttgatctt
tccatgaaggacaagccacggtctcccttcagcaagctcaaggacagagtgaagggcaag
aagaagtatgatctcgaatctgcctcagcgattcttccaagcagcgccctggaggatcct
gagttaggcagcctgggcaagatgggcaaagccaaaggtttcttcctccgaaacaagcta
cgcaagtcctcgctcacacagtctaacacctctctgggctctgacagcaccttgtcttcc
actagtggcagcctggtctaccagggacccggggcggagctcctcacccgctcaccaagc
cacagcagctggctgtccactgaagggggtagggactctatacagtcccccaagctgctc
acccacaagaggacatacagtgatgaggccagccagcttcgagcagctcctccccgggcc
cttcttgagctccaaggccaccttgatggtgcctcccgctcttccctctgcgtcaatggg
agccatgtgtacaatgaggaacctcagccccccttacggcaccgcagctccatctcaggc
ccctttccaccttcaagctccttacacagtgtcccacctcggtcctctgaggaggggtct
cggtcctcggatgattcttggggcagaggcagccatggcaccagcagctcagaggcagtg
cctggacaggaggagctgagcaagcaggccaaaggggccagttgctctggagaggaggag
ggggcccggttacccgaggggaagccagtccaggttgccacccccatggtggcctcctct
gaggctgtggcagcagaaaaggatcggaagccccgaatggggctcttccatcaccaccac
caccaagggctgagtcggagtgagcaggggcgccgtggctcagtcggggagaaggggagt
ccgtccctgggagcctccccccaccattcatccaccggggaggaaaaggccaagagtagc
tggtttggcctgagagaatccaaggagccaactcagaagcccagtccccaccctgtgaaa
ccccttactgctgcccctgtggaggctagccccgacaggaaacagccccgtaccagcctg
agcacagccctgagtagcggactggagaggctcaaaactgtcacatctggtggcatccag
tctgtgcttccagcgtcccagcttggctcaagtgtggacaccaagaggccaaaggattct
gctgtgctggaccagtcggccaagtactatcacctgactcatgatgagctcattggcctg
ctcctgcagcgtgagcgtgagctgagccagagagacgagcatgtgcaagaactggagagc
tacattgaccggctgctggtgcggatcatggagacctcgcccacactgctgcaaatctcc
cctggcccccccaagtag

DBGET integrated database retrieval system