KEGG   Mus musculus (mouse): 52123Help
Entry
52123             CDS       T01002                                 

Gene name
Agpat5, 1110013A05Rik, D8Ertd319e
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon)
  KO
K19007  lysophosphatidiate acyltransferase [EC:2.3.1.51]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04072  Phospholipase D signaling pathway
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    52123 (Agpat5)
   00564 Glycerophospholipid metabolism
    52123 (Agpat5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    52123 (Agpat5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     52123 (Agpat5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase Acyltransf_C
Motif
Other DBs
NCBI-GeneID: 52123
NCBI-ProteinID: NP_081068
MGI: 1196345
Ensembl: ENSMUSG00000031467
Vega: OTTMUSG00000030978
UniProt: Q9D1E8
Position
8 A1.3; 8 10.3 cM
AA seq 365 aa AA seqDB search
MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPARLYQRVDDRLYCVYQN
MVLFFFENYTGVQILLYGDLPKNKENVIYLANHQSTVDWIVADMLAARQDALGHVRYVLK
DKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAGTPMYLVIFPEGTRYNAT
YTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHLDAIYDVTVVYEGNEKGSG
KYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKWLHERFEIKDRLLIEFYDSP
DPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTESGRKLYMGTWLYGTLLGCLW
FVIKA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtccctggtgctccacacgtactctatgcgctacctgctccccagcgtcctg
ttgctgggctcggcgcccacctacctgctggcctggacgctgtggcgggtgctctccgcg
ctgatgcccgcccgcctgtaccagcgcgtggacgaccggctttactgcgtctaccagaac
atggtgctcttcttcttcgagaactacaccggggtccagatattgctatatggagatttg
ccaaaaaataaagaaaatgtaatatatctagcgaatcatcaaagcacagttgactggatt
gttgcggacatgctggctgccagacaggatgccctaggacatgtgcgctacgtactgaaa
gacaagttaaaatggcttccgctgtatgggttctactttgctcagcatggaggaatttat
gtaaaacgaagtgccaaatttaatgataaagaaatgagaagcaagctgcagagctatgtg
aacgcaggaacaccgatgtatcttgtgattttcccagagggaacaaggtataatgcaaca
tacacaaaactcctttcagccagtcaggcatttgctgctcagcggggccttgcagtatta
aaacacgtactgacaccaagaataaaggccactcacgttgcttttgattctatgaagagt
catttagatgcaatttatgatgtcacagtggtttatgaagggaatgagaaaggttcagga
aaatactcaaatccaccatccatgactgagtttctctgcaaacagtgcccaaaacttcat
attcactttgatcgtatagacagaaatgaagttccagaggaacaagaacacatgaaaaag
tggcttcatgagcgctttgagataaaagataggttgctcatagagttctatgattcacca
gatccagaaagaagaaacaaatttcctgggaaaagtgttcattccagactaagtgtgaag
aagactttaccttcagtgttgatcttggggagtttgactgctgtcatgctgatgacggag
tccggaaggaaactgtacatgggcacctggttgtatggaaccctccttggctgcctgtgg
tttgttattaaagcataa

DBGET integrated database retrieval system