KEGG   Mus musculus (house mouse): 52150
Entry
52150             CDS       T01002                                 
Symbol
Kcnk6, D7Ertd764e, Toss, Twik2
Name
(RefSeq) potassium inwardly-rectifying channel, subfamily K, member 6
  KO
K04917  potassium channel subfamily K member 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    52150 (Kcnk6)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   52150 (Kcnk6)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans DUF2101
Other DBs
NCBI-GeneID: 52150
NCBI-ProteinID: NP_001028697
MGI: 1891291
Ensembl: ENSMUSG00000046410
UniProt: Q3TBV4 Q3TQ68 Q3V1G1
Position
7:complement(28921353..28931947)
AA seq 313 aa
MRRGALLASALAAYAGYLALGALLVARLERPHEARLRAELGTLREQLLQHSPCVAAHALD
AFVERVLAAGRLGRAALANASGAANASDPAWDFASALFFASTLVTTVGYGYTTPLTDAGK
AFSIVFALLGVPITMLLLTASAQRLSLLLTHAPLSWLSLHWGWPPQRAARWHLVALLMVI
VAIFFLVPAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTA
YLFLGLVAMVLVLQTFRRVSDLHGLTELILLPDPDPASLSQDEDDQVAVLDARTDLHQHL
SAASHADYASIPR
NT seq 942 nt   +upstreamnt  +downstreamnt
atgcggcggggcgcgctcctggctagcgccctggccgcctacgccgggtacctggcgctg
ggcgcgctgcttgtggcgcggctggagcggcctcacgaagcccggctgcgggcagaactg
gggaccctgcgggagcagctgctacagcacagcccgtgcgtggcggctcacgccctggat
gccttcgtggagcgggtgctggcggccggacggctggggcgcgcagcgctcgccaacgcc
tcgggagctgccaacgcttcggaccctgcgtgggacttcgcctcggcgctcttcttcgcc
agcacgcttgtcaccaccgtgggctatggctacacgaccccactgacagatgctggcaaa
gccttctccatcgtctttgcactcctgggcgtgcctatcaccatgctacttctgactgcc
tcagcccagcgcctgtcactgctgctcacccacgcacccctgtcctggctgagcctgcac
tggggctggcccccgcagcgggcagcccgctggcacctggtggccctgctgatggtcata
gtggctatattcttcctggtaccggccgcggtcttcgcctaccttgaagaggcctggagt
tttctggatgctttctatttctgcttcatctctctgtccaccattggcctaggggactac
gtgcctggggaagccccaggccagccttaccgggccctctacaaggtgcttgtcacagcg
tacctcttcctcggcctggttgccatggtgctcgtgttgcagactttccgccgtgtttcc
gacctccatggcctcacagaactcatcttgctgcccgatccggaccctgccagcctcagc
caggatgaggatgatcaggtggccgttctggatgcccggacagatctacatcagcacctc
tctgctgcctcccacgctgactacgcctccatccccaggtag

DBGET integrated database retrieval system