KEGG   Mus musculus (mouse): 52231Help
Entry
52231             CDS       T01002                                 

Gene name
Ankzf1, 1300008P06Rik, 2810025E10Rik, D1Ertd161e
Definition
(RefSeq) ankyrin repeat and zinc finger domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 52231
NCBI-ProteinID: NP_001254549
MGI: 1098746
Ensembl: ENSMUSG00000026199
Vega: OTTMUSG00000021565
UniProt: Q80UU1
Position
1 C4; 1 38.62 cM
AA seq 239 aa AA seqDB search
MAKPAGDAAVGSRSGELFLPSVSSSATSPAPSAASAPASVSLLSLNGEAPLIRGLSLVSQ
APGEALAWAPRTSCPGENTSSGGKVSPYSLEISEKLFCSACDQIFQNHQEQREHYKLDWH
RFNLKQRLKNKPLLSASDFEQQSSTGDLSSISGSDDTDSSSEEDLLPLDEGRAESEKPNR
PPGFYPHRVLFKNAQGQFLYAYRCVLGPHQASNSPDCVLTPNFCILGFPQPMYVLFSSF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccggctggcgatgcggcagtaggatctcgttctggagagttgtttctgccc
tccgtttcttcttcagccacgtcgccagctccaagtgcagcctcagcccctgcctccgtt
tccctgttgtccctcaacggggaagctccactcattcggggcctgagcctggtgagccaa
gctcctggggaggctctggcctgggcgccgcgtacttcctgtccaggagagaacacaagc
tcggggggaaaagtatctccatattctctggaaatttcagagaaattattttgttcagcc
tgtgaccagatcttccagaaccaccaggaacagagagaacattataagcttgattggcat
cgctttaacttaaaacaacgtctcaagaacaagcctctcctgtctgcttcagactttgaa
cagcaaagctccacaggggatctttccagcatctcaggatcagatgacacagactccagc
agtgaagaggacttgctgccactggatgaggggagggctgaatccgagaaacctaaccgg
ccccccggattctacccacatcgggtccttttcaaaaacgcccagggccagtttctttat
gcctatcgttgtgtcctaggccctcaccaggcaagtaacagtccagattgtgtgctcact
cccaacttttgtatactaggttttcctcagccaatgtatgtcttattttcttccttttga

DBGET integrated database retrieval system