KEGG   Mus musculus (mouse): 52323
Entry
52323             CDS       T01002                                 

Gene name
Klhl7, 2700038B03Rik, D5Ertd363, D5Ertd363e, Klh, SBBI, SBBI26
Definition
(RefSeq) kelch-like 7
  KO
K10445  kelch-like protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    52323 (Klhl7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     52323 (Klhl7)
Motif
Pfam: Kelch_1 BACK BTB Kelch_6 Kelch_4 Kelch_2 Kelch_3 Kelch_5 Glyoxal_oxid_N
Other DBs
NCBI-GeneID: 52323
NCBI-ProteinID: NP_080724
MGI: 1196453
Ensembl: ENSMUSG00000028986
Vega: OTTMUSG00000053534
UniProt: Q8BUL5
Position
5 A3; 5 10.67 cM
AA seq 586 aa
MATSGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQRTLCDVILTVQERKIPAHRV
VLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDA
ANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHFTEVYKTD
EFLQLDVKRVTHLLSQDTLTVRAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISK
NFLSKTVQAEPLIQDNPECLKMVISGMRYHLLSPEDREELAGGTRPRRKKHDYRIALFGG
SQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKD
SWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQR
CSHGMVEANGLIYVCGGSLGNNVSGRVLSSCEVYDPATETWTELCSMIEPRKNHGLVFVK
DKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWRGVTVKCAAVGSVIYVLAGFQGVG
RLGHILEYNTETDKWIANSKVRAFPVTSCLICVVDTCGANEETLET
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggccacctccggcgtggaaaagagtagcaagaagaaaactgagaagaaacttgcggct
cgcgaagaagccaagctgctggcggggttcatgggcgtcatgaacaacatgaggaaacag
agaacactgtgtgacgtgatcctcactgtccaggaaagaaagatccccgctcaccgcgtt
gtcctggctgcagccagtcacttctttaacttaatgttcacaactaacatgcttgaatct
aagtcctttgaagtagaactcaaagatgctgaacctgatattattgaacaactggtggaa
tttgcttatactgctagaatttctgtgaatagcaacaatgttcagtctttgttagatgca
gcaaatcagtaccagattgaacctgtgaagaaaatgtgtgttgattttttgaaagaacaa
gttgatgcttcaaattgtcttggtataagtgtgcttgcagagtgtctggactgtcctgaa
ctgaaagctacagctgatgacttcattcatcagcatttcactgaggtttacaaaacagat
gaattcctgcagcttgatgtcaagcgagtgacacatcttctcagccaggacaccctgact
gtgagagcagaggaccaggtttatgacgctgccgtgaggtggttgaaatatgatgagcct
aaccgccagccattcatggttgatatccttgctaaagtcaggtttcctcttatatcgaag
aatttcctaagtaaaacagtacaagctgaaccacttattcaagataatcctgaatgcctt
aaaatggtgataagtggaatgaggtaccatctgctgtctcctgaggatcgagaagaactt
gcaggtggcacacggcctagaagaaagaaacatgattaccgcatagctctgtttggaggc
tcccaaccacagtcctgtagatattttaacccaaaggattacagttggacagacattcgc
tgcccctttgaaaaacgaagagatgcagcatgtgtgttttgggacaatgtagtatacatt
ttgggaggttctcagcttttccccataaagcgaatggattgctacaatgttgtaaaggat
agctggtattccaaactgggccctccaacacctcgagacagccttgctgcctgtgcagca
gaaggcaaaatttatacatctggaggttcagaagtaggaaactcggccctgtatttgttt
gaatgctatgatacaaggaccgagagttggcacacgaagcccagcatgctgactcagcgc
tgcagccatgggatggtggaggccaatggcctcatctatgtttgtggtggaagcttagga
aacaatgtttctgggagagtgcttagttcctgtgaagtgtatgatcctgccacagaaaca
tggactgagctgtgttcaatgattgagcccaggaagaatcatgggctggtgtttgtgaag
gacaagatatttgctgtcggtggtcagaatggtttaggtggtctggacaatgtggaatat
tacgatatcaagttaaatgaatggaagatggtgtcaccgatgccatggaggggtgtcacg
gtgaagtgtgcagcagttggctctgtcatctatgtcctggcaggttttcagggtgtaggc
agattggggcatatccttgagtataatactgaaacagataagtggatcgccaactcaaaa
gtccgggctttcccagtcacaagttgtctaatttgtgttgttgatacttgtggagcaaat
gaagagacccttgaaacatga

DBGET integrated database retrieval system