KEGG   Mus musculus (mouse): 52331
Entry
52331             CDS       T01002                                 

Symbol
Stbd1, D530019K15Rik, D5Ertd593e
Name
(RefSeq) starch binding domain 1
  KO
K22267  starch-binding domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    52331 (Stbd1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Glycophagy associated proteins
    52331 (Stbd1)
SSDB
Motif
Pfam: CBM_20
Other DBs
NCBI-GeneID: 52331
NCBI-ProteinID: NP_780305
MGI: 1261768
Ensembl: ENSMUSG00000047963
Vega: OTTMUSG00000055606
UniProt: Q8C7E7
Position
5:92750910..92754438
AA seq 338 aa
MGAVWSALLVGGGLAGALILWLLRGDSGAPGKDGVAEPPQKGAPPGEAAAPGDGPGGGGS
GGLSPEPSDRELVSKAEHLRESNGHLISESKDLGNLPEAQRLQNVGADWVNAREFVPVGK
IPDTHSRADSEAARNQSPGSHGGEWRLPKGQETAVKVAGSVAAKLPSSSLLVDRAKAVSQ
DQAGHEDWEVVSRHSSWGSVGLGGSLEASRLSLNQRMDDSTNSLVGGRGWEVDGKVASLK
PQQVSIQFQVHYTTNTDVQFIAVTGDHESLGRWNTYIPLHYCKDGLWSHSVFLPADTVVE
WKFVLVENKEVTRWEECSNRFLQTGHEDKVVHGWWGIH
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgggcgccgtctggtcagccctgctggtcggcgggggtctagctggagcgctcatcctg
tggctgctgcggggagactctggggccccggggaaagacggggttgcggagccgccgcag
aagggcgcacctcctggggaggctgcggccccgggagacggtccgggtggtggtggcagt
ggcggcctgagccctgaaccttccgatcgggagctggtctccaaagcagagcatcttcga
gaaagcaacggacatttgatttctgagagcaaagatcttggtaacctgccggaagcacag
cggctgcagaatgttggagcagactgggtcaatgccagagagtttgttcctgttgggaag
attccagacacacactccagggccgactctgaagcggcaagaaatcaaagcccaggatct
catggaggagaatggagactccccaaaggacaagaaacagctgtcaaagtagctggcagt
gtggccgcaaagctgccctccagcagcctgcttgtggacagagctaaagcagtcagtcag
gaccaggcaggccacgaggactgggaagtggtgtctaggcactcatcttgggggagtgtt
ggtttgggtggcagtcttgaggcttctaggttaagtctaaatcagagaatggacgacagc
acaaacagtcttgtgggaggaagaggctgggaagtagatgggaaagtggcatctctgaaa
cctcaacaggtcagcatccagttccaggtgcactacaccacaaacaccgatgtgcagttc
attgcagtgactggagaccatgagagccttgggagatggaacacatacatcccactccac
tactgcaaagacgggctctggtctcattctgtcttcctgcctgcagacacagtggtggag
tggaagttcgtgttggtagagaataaggaagttactcgttgggaagaatgcagcaataga
ttcctgcagactggccatgaggataaagtggttcatgggtggtgggggattcactga

DBGET integrated database retrieval system