KEGG   Mus musculus (house mouse): 52430
Entry
52430             CDS       T01002                                 
Symbol
Echdc2, 1300017C12Rik, 2610009M20Rik, D4Ertd765e
Name
(RefSeq) enoyl Coenzyme A hydratase domain containing 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 52430
NCBI-ProteinID: NP_081004
MGI: 1289238
Ensembl: ENSMUSG00000028601
UniProt: Q3TLP5
Position
4:108022630..108036505
AA seq 296 aa
MLRVLPRALRLPCSWRFSGARDCASHATTRTPEIQVQALTGPNQGITEILMNRPNARNAL
GNVFVSELLEALAQLREDQQVRVLLFRSAVKGVFCAGADLKEREQMSDVEVGTFVQRLRG
LMSEIAAFPVPTIAAMDGFALGGGLELALACDLRIAASSAVMGLIETTRGLLPGAGGTQR
LPRCLGVALAKELIFTGRRLNGAQARELGLVNHAVAQNEEGNAAYHRALALAQEILPQAP
IAVRLGKVAIDRGMEVDIASGMAIEQMCYAQNIPTQDRLEGMAAFREKRAPKFVGK
NT seq 891 nt   +upstreamnt  +downstreamnt
atgctacgcgtactgccccgcgcgctgcgcctcccgtgctcctggaggttctcgggggcc
cgggactgcgcctctcacgcgacgaccaggacacccgaaatccaagtgcaggctctgaca
ggtcccaaccaaggaatcactgagattctgatgaacagacctaatgcccgcaatgccttg
gggaatgtgtttgttagtgagctgctggaagctctggcccagcttcgggaagaccagcaa
gtccgggtcctgctcttcagaagtgcggtgaagggagtgttctgtgcaggtgcagacctg
aaggagcgggagcagatgagtgatgtggaggtggggacctttgtccagcggctccgaggc
ctgatgagtgagatcgcagccttccctgtgcccaccattgcagccatggatgggtttgcc
ttaggcgggggcttggaacttgccctggcctgtgacctccgaatagcagcttcttcggct
gtcatggggctaattgagaccactcgaggacttctcccaggagcaggagggactcagagg
ctgcctcgctgcctgggcgtggccctagcgaaggagctcatcttcacaggccggcgactg
aacggggcacaggcccgtgagttgggcctggtaaatcatgccgtggctcagaatgaggag
ggtaacgctgcctaccaccgggccctggcactggcacaggagatcctgccccaggctccc
attgctgtgcgcctgggcaaagttgccatcgacagaggaatggaggtggacattgcatca
gggatggccatagaacagatgtgctatgcccagaacatcccaacccaggacaggctggaa
ggaatggcagccttcagggagaaacgagctcccaaatttgtgggcaagtga

DBGET integrated database retrieval system