KEGG   Mus musculus (mouse): 52432
Entry
52432             CDS       T01002                                 

Gene name
Ppp2r2d, 1300017E19Rik, D7Ertd753e, MDS026
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, delta
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    52432 (Ppp2r2d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    52432 (Ppp2r2d)
   04071 Sphingolipid signaling pathway
    52432 (Ppp2r2d)
   04151 PI3K-Akt signaling pathway
    52432 (Ppp2r2d)
   04152 AMPK signaling pathway
    52432 (Ppp2r2d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    52432 (Ppp2r2d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    52432 (Ppp2r2d)
  09156 Nervous system
   04728 Dopaminergic synapse
    52432 (Ppp2r2d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    52432 (Ppp2r2d)
   05165 Human papillomavirus infection
    52432 (Ppp2r2d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    52432 (Ppp2r2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    52432 (Ppp2r2d)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    52432 (Ppp2r2d)
   03036 Chromosome and associated proteins [BR:mmu03036]
    52432 (Ppp2r2d)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     52432 (Ppp2r2d)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     52432 (Ppp2r2d)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     52432 (Ppp2r2d)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 52432
NCBI-ProteinID: NP_080667
MGI: 1289252
Ensembl: ENSMUSG00000041769
Vega: OTTMUSG00000029360
UniProt: Q925E7
Position
7 F4; 7 82.95 cM
AA seq 453 aa
MAGAGGGGCPAGGNDFQWCFSQVKGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKGRAHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHAKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMEGRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRNTRRDVTLEASRENSKPRASLKPRKVCTGGKRKKDEISVDSLD
FNKKILHTAWHPMESIIAVAATNNLYIFQDKIN
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggcggcggctgcccggcgggcggcaacgacttccagtggtgcttc
tcgcaggtgaagggcgctgtcgacgaggacgtggcggaagccgacatcatctccaccgtt
gagtttaactactctggagaccttcttgcaacaggagacaaaggtggcagagttgttatt
ttccagcgggaacaagagaataaaggccgcgctcactctaggggagagtacaatgtttac
agtacctttcagagtcatgagccagagtttgactatttgaaaagtctagaaattgaagaa
aaaattaataaaatcaggtggttaccgcaacagaatgctgctcattttctactctctaca
aatgataaaactattaaattatggaaaataagtgaacgggataaaagagcagaaggttat
aacttgaaagatgaagatggacgacttcgagacccatttagaattacggcactacgggtt
ccaatattgaagcccatggaccttatggtagaagcaagtccacgacgaatttttgcaaat
gctcatacatatcacataaattccatttcagtaaatagtgatcatgaaacatatctctct
gcagatgatctgagaattaacctatggcatttagaaatcacagatagaagcttcaacatt
gtggacatcaagccagctaatatggaggagctgacagaagtcatcactgccgcagagttc
cacccacatcagtgcaatgtatttgtttacagcagcagcaagggcaccatcaggctgtgt
gacatgcgttcctctgccctatgtgacaggcatgccaagttttttgaagagccagaagat
cccagcagtagatccttcttctcagaaataatctcatctatatctgatgtcaagttcagc
cacagtggtcgatacatgatgaccagagactatctgtcggtgaaggtctgggacctcaac
atggagggcaggcctgtggagacccaccaggtacatgagtacctgcgaagcaagctctgc
tccttgtatgagaacgactgcatctttgacaagttcgagtgctgctggaacggttcagac
agtgccattatgacggggtcctacaacaacttctttagaatgtttgatagaaacactcgg
agggatgttacactggaagcctcaagagagaacagcaaaccccgagccagcctgaagccc
cggaaagtatgtacagggggtaagagaaagaaagacgagattagcgtggacagtttggac
ttcaataagaagatcctccacacagcctggcaccccatggagagcattattgctgtagct
gccaccaataacttgtatatattccaggacaaaattaattaa

DBGET integrated database retrieval system