KEGG   Mus musculus (mouse): 52477
Entry
52477             CDS       T01002                                 

Symbol
Angel2, 2610307I21Rik, 5730410O10Rik, AI845692, D1Ertd396e, D1Ertd654e
Name
(RefSeq) angel homolog 2
  KO
K18729  protein angel
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    52477 (Angel2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     52477 (Angel2)
SSDB
Motif
Pfam: ANGEL2_N Exo_endo_phos
Other DBs
NCBI-GeneID: 52477
NCBI-ProteinID: NP_067396
MGI: 1196310
Ensembl: ENSMUSG00000026634
Vega: OTTMUSG00000021514
UniProt: Q8K1C0
Position
1:190657305..190679160
AA seq 544 aa
METWRCVRRGYGRCVAGRGRYSMFPYPLKSLGRDWTTPWEDLQKYCWRRHISSCLRWPGH
YSRAPYPYFSSRHFSLNCRPPFLFESGTQFQYYNWRSDHLSNASLIHLSRHVMTSDRDEP
LSKRRKHQGTIKRNWEYLCSHNKENTKDLEDRNVDSTCEDREDKFDFSVMSYNILSQDLL
EDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGTEIRPSLESLGYH
CEYKMKTGRKPDGCAICFKHSRFSLLSVNPVEFCRRDIPLLDRDNIGLVLLLQPKIPRAA
SPSICIANTHLLYNPRRGDIKLTQLAMLLAEIANVTHRKDGSSCPIVMCGDFNSVPGSPL
YSFIKEGKLNYEGLAIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEAQQVPKVEKT
DSDVTQAQQEKAEVPVSADKVSSHLQHGFSLSSVYSHYVPDTGVPEVTTCHSRSAITVDY
IFYTAKKENTAQGPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNEHNSSDHLPLLAKF
RLEL
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggagacgtggcgctgtgtgaggaggggctacggccgctgtgtggcggggcgaggccga
tactccatgtttccctatcctctaaagagtttgggtcgagactggaccacgccgtgggag
gatctacagaaatattgctggcgcagacacatttccagttgtctgaggtggccaggacat
tactcccgtgcgccttacccatacttcagtagcaggcatttctcattgaactgtagacca
ccttttctgtttgagtctggaacgcagtttcagtactataattggagatctgaccacctt
agcaacgcatccttgatccatctctctcgtcacgtcatgacctctgacagagatgagccc
ttatctaaacgaagaaaacatcaaggaacaataaaaaggaactgggagtatttatgtagc
cataataaagaaaatacgaaggacctagaagacagaaatgttgactccacgtgtgaggac
cgtgaagataagtttgacttctcagtgatgtcttataacatcctctcgcaggatttactg
gaggataactctcacctctacagacattgccgacgtccagtgttacactggagttttcgg
ttccccaatatcttgaaagaaatcaaacattttgatgcagatgtgctttgtctacaggaa
gttcaagaagatcattatgggacagaaatcaggccaagtctggaatcactgggttatcat
tgtgaatataaaatgaaaacaggaaggaagcccgacggctgtgccatctgcttcaaacat
tccaggttctcgctcttatctgtgaacccagtggagttctgccgccgcgacattcctctg
ctggacagggacaacattggattggttttactcctgcagcccaagatcccacgcgctgcc
tctccatccatctgcatagctaacacacatctgctctataatccacggcgcggtgacatt
aagctgacccagctggcaatgctgctagctgagattgccaatgtgacccatcgcaaagat
ggcagctcctgtcctattgtcatgtgtggtgactttaattctgttcctggttctccactc
tatagtttcataaaggaaggaaaattaaattatgaaggtcttgcaattggaaaggtatct
ggccaggaacagtcttcacggggacaaagaattttatctattccaatttggcccccaaac
ctaggcatctctcagaactgtgtttatgaggcacagcaggttcccaaagtagaaaaaaca
gacagtgatgtgactcaagcacagcaggagaaagcggaggtcccagtgtcagctgacaaa
gtgtcctcgcatctacagcacggtttcagcttgtcatctgtctattcccattatgttcct
gacactggagttccagaggtgaccacctgccattcccgaagtgccataactgttgattat
attttctacactgcaaagaaggagaacactgctcaggggccaggagctgaagttgctttg
gttggtggcttgaaacttctagctagactgtcacttctaacagagcaagacttgtggact
gtgaacggccttcccaatgagcacaactcctcagatcacctgcctttgctggccaagttc
aggcttgagctctga

DBGET integrated database retrieval system