KEGG   Mus musculus (mouse): 52535
Entry
52535             CDS       T01002                                 

Gene name
Mettl17, 2310032K15Rik, D14Ertd209, D14Ertd209e, Mett11d1
Definition
(RefSeq) methyltransferase like 17
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Rsm22 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 Methyltransf_31 MTS
Other DBs
NCBI-GeneID: 52535
NCBI-ProteinID: NP_001025161
MGI: 1098577
Ensembl: ENSMUSG00000004561
Vega: OTTMUSG00000036453
UniProt: Q3U2U7
Position
14 C2; 14 26.71 cM
AA seq 461 aa
MATARTPRFLLLFCRSCRSLRGPQSRAYAALVPGVSQVDNGSDFLGKKPHRKHPGILHLP
HVQLPQALADAAQLMLFERPMRSVEKQVQALTNYLWSRHLPVEPEELQRRAAYLEKKFLE
KQDSAPTEEKLREAVLHALRKTTYHWQELSYSEELSLIYMAARLDGGFAAVFRAFHEIQA
RIPEFRPQTLMDFGSGTGSVAWAAHRTWGQSLREYVCVDSSAAMLGLAEKLLKGGSESGK
PCIPGVFFRQFLPVSPKVQFDVVVSAYALSELPSRADRIEVIQNLWRKTSHFLVLVENGT
KAGHRLLMDARNLVLGEKEKSPLDLRPSFVFAPCPHELPCPQLNASKSLACSFSQAYHPI
PFNWNKKPKEEIFSMVILARGSPKEANRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVVT
ARRHGRDLYRCARVSSWGDLLPVIAPSEFPPSSPDEEPPEN
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggccaccgccaggacaccgagatttctgctgctgttctgcagatcctgccgcagcctt
cgaggaccccagtcccgagcatacgccgcccttgtgcccggtgtgtcccaggtagacaac
gggtcggatttcctggggaagaagccccatcgaaagcatcccggcatcctgcatcttccg
cacgtccagctgccgcaagcactggctgacgccgcacagttaatgctttttgagagaccc
atgcgcagtgtagagaagcaggtgcaagcactcaccaactatctctggagccgacattta
cctgtagagccggaggagttgcaaagacgggctgcgtatcttgagaaaaaattcctggaa
aaacaagactcagctcccacagaggagaaacttcgtgaggcagtactgcatgccctgcgc
aaaactacctaccattggcaggaactcagctacagtgaagagctgagtctgatctatatg
gcagccagattggacggtggttttgctgcagttttcagggcattccatgagatccaggct
cgaatcccagagtttcggccacagacgttgatggactttgggtctggcactggttctgtc
gcctgggctgcccacagaacttggggccagagcctccgtgaatacgtgtgtgtggacagt
tcagctgccatgttgggtttggcggagaagcttctgaaaggtggttcagaatcagggaag
ccctgtatcccaggtgtctttttcagacagtttctacctgtgtcacccaaggtccagttt
gatgtggtggtatcagcctacgccctcagtgaactacccagcagggctgatcgcattgag
gtcattcagaacttgtggcgtaagacaagccattttctggtattggtggagaacggaacc
aaagctgggcaccgacttctcatggatgccaggaacctggtcctcggggaaaaagagaag
tcacctttggaccttcgacctagctttgtctttgccccatgtccccatgaacttccctgt
cctcagctgaatgcctccaagtccctggcctgtagcttctcccaggcttatcatccaatc
ccctttaactggaataagaaaccaaaggaggaaatattctctatggtaatccttgccaga
gggtctccaaaggaagctaaccgctggccccgaatcacgcagcccgtccttaaacggcct
cgccatgtgcattgccacctctgttgtccagacgggcacatgcagcacgctgtggtgaca
gcccgtcggcacggcagggatttgtaccgctgtgcccgtgtcagctcctggggagacctt
ttacctgtgatcgctccatccgagtttcctccttcgtcccctgatgaagagccccctgag
aattga

DBGET integrated database retrieval system