KEGG   Mus musculus (mouse): 52538Help
Entry
52538             CDS       T01002                                 

Gene name
Acaa2, 0610011L04Rik, AI255831, AI265397, D18Ertd240e
Definition
(RefSeq) acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase)
  KO
K07508  acetyl-CoA acyltransferase 2 [EC:2.3.1.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
Module
mmu_M00085  Fatty acid elongation in mitochondria
mmu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    52538 (Acaa2)
   00071 Fatty acid degradation
    52538 (Acaa2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    52538 (Acaa2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     52538 (Acaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 52538
NCBI-ProteinID: NP_803421
MGI: 1098623
Ensembl: ENSMUSG00000036880
UniProt: Q8BWT1
Position
18 E2; 18 50.76 cM
AA seq 397 aa AA seqDB search
MALLRGVFIVAAKRTPFGAYGGLLKDFSATDLTEFAARAALSAGKVPPETIDSVIVGNVM
QSSSDAAYLARHVGLRVGVPTETGALTLNRLCGSGFQSIVSGCQEICSKDAEVVLCGGTE
SMSQSPYCVRNVRFGTKFGLDLKLEDTLWAGLTDQHVKLPMGMTAENLAAKYNISREDCD
RYALQSQQRWKAANEAGYFNEEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPSVFK
KDGTVTAGNASGVSDGAGAVIIASEDAVKKHNFTPLARVVGYFVSGCDPTIMGIGPVPAI
NGALKKAGLSLKDMDLIDVNEAFAPQFLSVQKALDLDPSKTNVSGGAIALGHPLGGSGSR
ITAHLVHELRRRGGKYAVGSACIGGGQGIALIIQNTA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctacgaggtgtgttcatcgtcgctgcgaagcgaacaccctttggagcttac
gggggccttctcaaggacttctctgccaccgatttaactgaatttgctgccagggctgct
ctgtctgctggcaaagttccacctgaaaccatcgatagtgtcatcgtgggcaatgtcatg
cagagctcttcagatgcggcatacctggcgaggcatgtgggtttgcgagtgggagtccca
acagagactggggcccttaccctcaacaggctctgtggctctggtttccagtccatcgtg
agcggatgtcaggaaatctgttctaaagatgctgaggtcgtcttgtgtggaggaacagag
agcatgagccagtccccctactgtgtcagaaatgtgcgcttcggaaccaaatttggatta
gatctcaagctggaagatactttgtgggcaggattaacggatcaacatgttaagctgccc
atgggaatgactgcagagaaccttgctgcaaaatacaacataagcagagaagactgtgac
agatacgccttgcagtctcagcagaggtggaaagctgctaacgaggctggctacttcaat
gaggagatggcacccattgaggtgaagacgaagaaaggcaaacagaccatgcaagtggac
gagcacgctcgaccccaaaccaccctggagcaactgcagaagctcccgtccgtgttcaag
aaagacgggacagtcacagcagggaacgcctcgggggtgtctgacggtgctggggccgtc
atcatagccagcgaagatgctgtcaaaaaacataacttcacgcccctggccagagtcgtg
ggctacttcgtgtccggatgcgatcctactatcatgggtattggtccagtccctgctatc
aatggagcattgaagaaagctgggctgagtcttaaggacatggatttgatagacgtgaac
gaagcttttgcccctcagttcttgtctgttcagaaggccctggatcttgaccccagcaaa
accaatgtgagtggaggcgccattgccctgggtcacccgctgggaggatctggctccaga
atcaccgcacacctggttcatgagttaaggcgtcgaggtggaaagtacgcagtgggatca
gcttgcattggaggtggccaaggcatcgccttgatcatccagaacacagcctga

DBGET integrated database retrieval system