KEGG   Mus musculus (mouse): 52551
Entry
52551             CDS       T01002                                 

Gene name
Sgta, 5330427H01Rik, AI194281, D10Ertd190e, Sgt, Stg
Definition
(RefSeq) small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    52551 (Sgta)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   52551 (Sgta)
SSDB
Motif
Pfam: TPR_1 SGTA_dimer TPR_2 TPR_8 TPR_11 TPR_17 TPR_16 TPR_7 TPR_14 TPR_12 TPR_10 TPR_19 TPR_9 NARP1 TPR_6 TOM20_plant BTAD DUF627
Other DBs
NCBI-GeneID: 52551
NCBI-ProteinID: NP_078775
MGI: 1098703
Ensembl: ENSMUSG00000004937
UniProt: Q8BJU0
Position
10 C1; 10 39.72 cM
AA seq 315 aa
MDNRKRLAYAIIQFLHGQLRHGGLSCDAQESLEVAIQCLETAFGVTLEDSDLALPQTLPE
IFEAATSSKQEMPQDPRAPDRTPPSEEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIE
LNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAV
AYYKKALELDPDNDTYKSNLKIAELKLREAPSPTGGVGSLDIAGLLNNPHFITMASSLMN
SPQLQQLMSGMISGGHNPLGTPGSSPQQSDLASLIQAGQQFAQQMQQQNPEFVEQIRSQV
VRSRTPSASHEEQQE
NT seq 948 nt   +upstreamnt  +downstreamnt
atggacaacaggaagcgcctggcctatgccatcatccagttcctccatggccagttgcgg
cacggtgggctctcgtgtgacgcccaggagagcctagaggttgccatccagtgtctggag
acagccttcggggtgacgctggaggacagtgaccttgctctcccccagaccctgccagag
atatttgaagcagccacttccagcaagcaggagatgccacaggacccgcgggcccctgac
aggacaccaccctctgaagaggactcagctgaggcagagcgcctcaaaacggaaggtaat
gagcagatgaagctggagaacttcgaggcggctgtgcacctctacggcaaggccattgag
ctcaaccctgccaatgctgtctacttctgtaacagagctgcggcctacagcaagctgggg
aactacgtgggggccgtgcaggactgcgagcgcgccattggcatcgaccctgggtatagc
aaggcctatggccgcatgggccttgcactatccagcctgaacaagcatgcagaggctgtg
gcatactacaagaaggccctggagctggaccctgacaacgacacatacaagtccaacctc
aagattgcagagctgaagttacgggaggcgccaagccctacgggcggcgtgggcagctta
gacatcgctggcctgctgaacaacccacacttcatcaccatggcttcgagcttaatgaac
agcccccagctacagcagctcatgtcgggcatgatctccggaggccataaccctctgggc
acgccaggcagcagtccgcagcagagtgacctggccagcctcatccaggcgggccaacag
tttgcacagcagatgcagcagcagaacccagagtttgtggagcagatccggagccaggtg
gtgcgcagccggacacccagtgccagccatgaggagcagcaagagtga

DBGET integrated database retrieval system