KEGG   Mus musculus (mouse): 52609
Entry
52609             CDS       T01002                                 

Gene name
Cbx7, 1600014J01Rik, AI851678, D15Ertd417e
Definition
(RefSeq) chromobox 7
  KO
K11454  chromobox protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    52609 (Cbx7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     52609 (Cbx7)
SSDB
Motif
Pfam: Chromo CBX7_C Mtf2_C MotY_N
Other DBs
NCBI-GeneID: 52609
NCBI-ProteinID: NP_659060
MGI: 1196439
Ensembl: ENSMUSG00000053411
Vega: OTTMUSG00000017275
UniProt: Q8VDS3
Structure
PDB: 

Position
15 E1; 15 37.85 cM
AA seq 158 aa
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPRRLLLQESAAPDVVQTPGDWEPMEQAPEEEAEADLTNGPPPWTP
TLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRNEKL
NT seq 477 nt   +upstreamnt  +downstreamnt
atggagctgtcagccataggcgagcaggtgtttgcggtggagagcatccggaagaagcgc
gtgcggaagggcaaagttgaatatctggtgaagtggaaaggatggccccccaagtatagc
acctgggagccagaggagcacatcttggaccctcgccttgtcatggcctacgaggagaag
gaggagagagaccgagcctcggggtataggaagagaggtccgaaacccaggcggcttctg
ctacaggagtcagcagccccagacgttgtgcagacccccggagactgggagcctatggag
caagcccccgaggaggaggcagaagcagacctgaccaatgggccgcctccctggacaccc
acgctcccctcaagtgaagttaccgtgactgacatcaccgccaactccgtcaccgtcacc
ttccgcgaggctcaagccgccgagggcttcttccgagaccgcaacgagaagctgtga

DBGET integrated database retrieval system