KEGG   Mus musculus (mouse): 52615Help
Entry
52615             CDS       T01002                                 

Gene name
Suz12, 2610028O16Rik, AI195385, AU016842, AW536442, D11Ertd530e, mKIAA0160
Definition
(RefSeq) SUZ12 polycomb repressive complex 2 subunit
  KO
K11463  polycomb protein SUZ12
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH1 complex
     52615 (Suz12)
    PRC2-EZH2 complex
     52615 (Suz12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEFS-Box DUF2070
Motif
Other DBs
NCBI-GeneID: 52615
NCBI-ProteinID: NP_954666
MGI: 1261758
Ensembl: ENSMUSG00000017548
Vega: OTTMUSG00000000192
UniProt: Q80U70
Position
11 B5; 11 47.36 cM
AA seq 741 aa AA seqDB search
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVAAAASGGKSGGGGCGGGGSYSASSSSAA
AAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYM
SHRNSRTSIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSQNSENE
QNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFE
PSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEELPARRKRNREDGEKTFVAQ
MTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFT
LRWTGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQTIAVKETLTTELQTRKEKDN
SNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNY
VYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKA
SMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTIT
QIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFML
HLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESATPSNEEIAEEQNGTANGFSETNSK
EKALETDGVSGVPKQSKKQKL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcagaagcacggcggtgggggagggggcggctcggggcccagcgcggggtcc
gggggaggcggcttcgggggttcggcggcggcggtggcggcggcggcttcgggcggcaaa
tccggcggcgggggctgtggaggcggcggcagttactcggcctcctcctcctcggcggcg
gccgcggcggcggcggcgggggccgcggtgttgccggtgaagaagccgaaaatggagcac
gtccaggctgaccacgagcttttcctccaggcctttgagaaaccaacacagatatataga
tttcttcgaactcgaaatcttatcgcaccaatatttttgcacagaactcttacttacatg
tctcatcgaaattccagaacaagcatcaaaaggaaaacatttaaagttgatgatatgtta
tcaaaagtagagaaaatgaaaggagagcaagaatctcatagcttgtctgcacatttgcaa
cttacatttaccggtttcttccacaaaaatgataagccatcacaaaactcagaaaatgaa
caaaattctgttaccctggaagtcctgcttgtgaaagtttgccacaaaaaaaggaaggat
gtaagttgtccaataagacaagtccctactggtaaaaagcaggtgcctttgaatcctgac
ctcaatcaaacaaaaccaggaaattttccatccctggcagtttccagtaatgaatttgaa
cctagtaacagccatatggtgaagtcctactcgttgctgtttagagtaactcgtccagga
agaagagaatttaatggaatgattaatggagaaaccaatgaaaatattgatgtcagtgaa
gaacttccagccagaagaaaacgaaatcgcgaagatggagaaaagacatttgttgcacaa
atgacagtttttgacaaaaacaggcgtttacagcttttagatggggaatatgaagtggcc
atgcaggaaatggaagaatgtccaataagtaagaaaagagcaacatgggagacaattctt
gatgggaagaggctgcctccatttgagacattttctcagggacctacattacaatttact
cttcgatggacaggagaaaccaacgataagtctacagctcctgttgccaagcctcttgcc
actagaaattcagagagccttcatcaggaaaataagcctggttctgttaaacctgcacaa
actattgctgttaaggagacgctgactacagagctgcaaacaagaaaagaaaaggataat
tcaaatgaaagtcgccagaagttaagaatattttatcagttcctttataacaataataca
agacaacagacagaagccagagacgacctgcactgcccgtggtgcactctgaactgccgt
aaactgtatagcttactcaaacatctaaagctctgccacagcaggttcatcttcaattac
gtatatcatccaaaaggtgctaggatagatgtttcaatcaatgagtgttatgatggctcc
tatgcaggaaatcctcaggatatacatcgccaacctggatttgcttttagtcgaaatgga
ccggtaaagagaacacctatcacacatattcttgtttgcaggccaaaaagaacaaaagca
agcatgtcggagtttcttgaatctgaagatggagaagtggagcagcagagaacatacagc
agtggccacaatcgtctctatttccacagtgatacctgcttacctcttcggccacaagaa
atggaagtagatagtgaagatgagaaagatccagaatggctgagagaaaaaaccattact
caaattgaagaattttctgatgtgaatgaaggagagaaagaagtgatgaagctgtggaac
ctccatgtcatgaagcatggatttattgctgacaatcaaatgaatcatgcctgtatgctg
tttgtagaaaattatggacagaaaataattaagaagaatttatgtcgaaacttcatgctt
catctagtcagcatgcatgactttaatcttattagcataatgtcaatagataaagctgtt
accaagctccgagaaatgcagcaaaaactagaaaaaggagaatctgcgaccccttcaaat
gaagaaatagctgaggaacaaaatggaacagcaaatggattcagtgaaactaactcaaaa
gagaaagctttggaaactgacggtgtctcaggggttccaaaacagagcaagaaacaaaaa
ctctga

DBGET integrated database retrieval system