KEGG   Mus musculus (house mouse): 52615
Entry
52615             CDS       T01002                                 
Symbol
Suz12, 2610028O16Rik, D11Ertd530e, mKIAA0160
Name
(RefSeq) SUZ12 polycomb repressive complex 2 subunit
  KO
K11463  polycomb protein SUZ12
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    52615 (Suz12)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH1 complex
     52615 (Suz12)
    PRC2-EZH2 complex
     52615 (Suz12)
SSDB
Motif
Pfam: VEFS-Box DUF2070
Other DBs
NCBI-GeneID: 52615
NCBI-ProteinID: NP_954666
MGI: 1261758
Ensembl: ENSMUSG00000017548
UniProt: Q80U70
Position
11:79883932..79924949
AA seq 741 aa
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVAAAASGGKSGGGGCGGGGSYSASSSSAA
AAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYM
SHRNSRTSIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSQNSENE
QNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFE
PSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEELPARRKRNREDGEKTFVAQ
MTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFT
LRWTGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQTIAVKETLTTELQTRKEKDN
SNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNY
VYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKA
SMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTIT
QIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFML
HLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESATPSNEEIAEEQNGTANGFSETNSK
EKALETDGVSGVPKQSKKQKL
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggcgcctcagaagcacggcggtgggggagggggcggctcggggcccagcgcggggtcc
gggggaggcggcttcgggggttcggcggcggcggtggcggcggcggcttcgggcggcaaa
tccggcggcgggggctgtggaggcggcggcagttactcggcctcctcctcctcggcggcg
gccgcggcggcggcggcgggggccgcggtgttgccggtgaagaagccgaaaatggagcac
gtccaggctgaccacgagcttttcctccaggcctttgagaaaccaacacagatatataga
tttcttcgaactcgaaatcttatcgcaccaatatttttgcacagaactcttacttacatg
tctcatcgaaattccagaacaagcatcaaaaggaaaacatttaaagttgatgatatgtta
tcaaaagtagagaaaatgaaaggagagcaagaatctcatagcttgtctgcacatttgcaa
cttacatttaccggtttcttccacaaaaatgataagccatcacaaaactcagaaaatgaa
caaaattctgttaccctggaagtcctgcttgtgaaagtttgccacaaaaaaaggaaggat
gtaagttgtccaataagacaagtccctactggtaaaaagcaggtgcctttgaatcctgac
ctcaatcaaacaaaaccaggaaattttccatccctggcagtttccagtaatgaatttgaa
cctagtaacagccatatggtgaagtcctactcgttgctgtttagagtaactcgtccagga
agaagagaatttaatggaatgattaatggagaaaccaatgaaaatattgatgtcagtgaa
gaacttccagccagaagaaaacgaaatcgcgaagatggagaaaagacatttgttgcacaa
atgacagtttttgacaaaaacaggcgtttacagcttttagatggggaatatgaagtggcc
atgcaggaaatggaagaatgtccaataagtaagaaaagagcaacatgggagacaattctt
gatgggaagaggctgcctccatttgagacattttctcagggacctacattacaatttact
cttcgatggacaggagaaaccaacgataagtctacagctcctgttgccaagcctcttgcc
actagaaattcagagagccttcatcaggaaaataagcctggttctgttaaacctgcacaa
actattgctgttaaggagacgctgactacagagctgcaaacaagaaaagaaaaggataat
tcaaatgaaagtcgccagaagttaagaatattttatcagttcctttataacaataataca
agacaacagacagaagccagagacgacctgcactgcccgtggtgcactctgaactgccgt
aaactgtatagcttactcaaacatctaaagctctgccacagcaggttcatcttcaattac
gtatatcatccaaaaggtgctaggatagatgtttcaatcaatgagtgttatgatggctcc
tatgcaggaaatcctcaggatatacatcgccaacctggatttgcttttagtcgaaatgga
ccggtaaagagaacacctatcacacatattcttgtttgcaggccaaaaagaacaaaagca
agcatgtcggagtttcttgaatctgaagatggagaagtggagcagcagagaacatacagc
agtggccacaatcgtctctatttccacagtgatacctgcttacctcttcggccacaagaa
atggaagtagatagtgaagatgagaaagatccagaatggctgagagaaaaaaccattact
caaattgaagaattttctgatgtgaatgaaggagagaaagaagtgatgaagctgtggaac
ctccatgtcatgaagcatggatttattgctgacaatcaaatgaatcatgcctgtatgctg
tttgtagaaaattatggacagaaaataattaagaagaatttatgtcgaaacttcatgctt
catctagtcagcatgcatgactttaatcttattagcataatgtcaatagataaagctgtt
accaagctccgagaaatgcagcaaaaactagaaaaaggagaatctgcgaccccttcaaat
gaagaaatagctgaggaacaaaatggaacagcaaatggattcagtgaaactaactcaaaa
gagaaagctttggaaactgacggtgtctcaggggttccaaaacagagcaagaaacaaaaa
ctctga

DBGET integrated database retrieval system