KEGG   Mus musculus (mouse): 52639Help
Entry
52639             CDS       T01002                                 

Gene name
Wipi1, 4930533H01Rik, AW411817, D11Ertd498e
Definition
(RefSeq) WD repeat domain, phosphoinositide interacting 1
  KO
K17908  autophagy-related protein 18
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    52639 (Wipi1)
   04136 Autophagy - other
    52639 (Wipi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    52639 (Wipi1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    52639 (Wipi1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    52639 (Wipi1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    52639 (Wipi1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    52639 (Wipi1)
Transporters [BR:mmu02000]
 Other Transporters
  Others
   52639 (Wipi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 BCAS3
Motif
Other DBs
NCBI-GeneID: 52639
NCBI-ProteinID: NP_666052
MGI: 1261864
Ensembl: ENSMUSG00000041895
Vega: OTTMUSG00000003347
UniProt: Q8R3E3
Position
11 E1; 11 72.18 cM
AA seq 446 aa AA seqDB search
MEAEAADAPPGRVEAALSCFSFNQDCTSLAIGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTVLDIPSNPTGLCALSINHSNSYLAYPGSQSTGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNSSGSKLASASEKGTVIRVFSVPEGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKMEHLTDSRPEEPSTWSGYMGKMFMAATNYLPAQVSDMMNQ
DRAFATGRLNFSGQKNICTLSTIQKLPRLLVASSDGHLYIYNLDPQDGGECVLIKTHSLL
SSGTTEENKENDLRPSLPPSYAATVARPSTSAASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGSQKGKTKQS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgaagccgcagatgcccctccgggccgagtggaggcggcgctcagctgcttc
tctttcaaccaagactgcacatccctagcgattggaaccaaggccggttacaagctgttt
tctctgagttctgtggagcagcttgaccaagtccatggaagcaatgaaatccctgacgtg
tatatcgtggagcgcctcttctccagcagcctggttgtagtggtcagtcacacaaaacct
cggcagatgaacgtctaccatttcaagaaaggcactgagatctgtaattacagctactcc
agcaacattttgtctattcggctcaaccgacagaggctgctggtctgcctggaagaatcc
atctatatccacaacattaaggatatgaagttattgaagaccgtcctggatattccctca
aacccaacaggtctctgtgccctgtctatcaaccattccaactcttacctggcctatcct
ggaagccagagtacaggcgagattgtactctatgatggaaactccctgaaaacggtgtgc
accattgctgcccacgaggggacgctggccgctatcaccttcaactcctcgggctccaag
ctagcaagcgcgtctgaaaaaggcactgtcatccgagtgttctctgttcccgagggccag
aaactctatgagtttcgtcgaggaatgaaaaggtatgtgacaatcagctccctggtgttc
agtatggactcccagttcctgtgtgcctccagcaacacggagaccgtgcacatcttcaag
atggaacacctgacagacagccgcccagaagagccttccacctggagcggctacatggga
aagatgttcatggcagctaccaactacctccccgcccaggtgtcggacatgatgaaccag
gacagggctttcgccacaggacgcctgaacttctctgggcagaagaacatttgcaccctg
tccacgatccagaaactgccgcggttgctggtggcctcctccgacggacacctttacatc
tacaacttggacccacaggatggaggagaatgtgtcctaatcaaaacccacagcttgctt
agctcaggaacaacagaagagaacaaagaaaatgacctcagaccttccttacctccatct
tatgctgcaactgtagcaaggcccagcacgtctgcagcctccacggtgccaggatactct
gaggacggcggggcgctccgaggggaagttattccggaacacgagtttgcgacgggacca
gtgtgtctagacgacgagaatgagtttccccctataatcttgtgccgtggaagtcagaag
ggcaaaacgaagcagtcctga

DBGET integrated database retrieval system