KEGG   Mus musculus (mouse): 52639
Entry
52639             CDS       T01002                                 

Gene name
Wipi1, 4930533H01Rik, AW411817, D11Ertd498, D11Ertd498e
Definition
(RefSeq) WD repeat domain, phosphoinositide interacting 1
  KO
K17908  autophagy-related protein 18
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    52639 (Wipi1)
   04136 Autophagy - other
    52639 (Wipi1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    52639 (Wipi1)
   05014 Amyotrophic lateral sclerosis
    52639 (Wipi1)
   05016 Huntington disease
    52639 (Wipi1)
   05017 Spinocerebellar ataxia
    52639 (Wipi1)
   05022 Pathways of neurodegeneration - multiple diseases
    52639 (Wipi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    52639 (Wipi1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    52639 (Wipi1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    52639 (Wipi1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    52639 (Wipi1)
SSDB
Motif
Pfam: DUF5711 ANAPC4_WD40 BCAS3
Other DBs
NCBI-GeneID: 52639
NCBI-ProteinID: NP_666052
MGI: 1261864
Ensembl: ENSMUSG00000041895
Vega: OTTMUSG00000003347
UniProt: Q8R3E3
Position
11 E1; 11 72.18 cM
AA seq 446 aa
MEAEAADAPPGRVEAALSCFSFNQDCTSLAIGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTVLDIPSNPTGLCALSINHSNSYLAYPGSQSTGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNSSGSKLASASEKGTVIRVFSVPEGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKMEHLTDSRPEEPSTWSGYMGKMFMAATNYLPAQVSDMMNQ
DRAFATGRLNFSGQKNICTLSTIQKLPRLLVASSDGHLYIYNLDPQDGGECVLIKTHSLL
SSGTTEENKENDLRPSLPPSYAATVARPSTSAASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGSQKGKTKQS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggaggccgaagccgcagatgcccctccgggccgagtggaggcggcgctcagctgcttc
tctttcaaccaagactgcacatccctagcgattggaaccaaggccggttacaagctgttt
tctctgagttctgtggagcagcttgaccaagtccatggaagcaatgaaatccctgacgtg
tatatcgtggagcgcctcttctccagcagcctggttgtagtggtcagtcacacaaaacct
cggcagatgaacgtctaccatttcaagaaaggcactgagatctgtaattacagctactcc
agcaacattttgtctattcggctcaaccgacagaggctgctggtctgcctggaagaatcc
atctatatccacaacattaaggatatgaagttattgaagaccgtcctggatattccctca
aacccaacaggtctctgtgccctgtctatcaaccattccaactcttacctggcctatcct
ggaagccagagtacaggcgagattgtactctatgatggaaactccctgaaaacggtgtgc
accattgctgcccacgaggggacgctggccgctatcaccttcaactcctcgggctccaag
ctagcaagcgcgtctgaaaaaggcactgtcatccgagtgttctctgttcccgagggccag
aaactctatgagtttcgtcgaggaatgaaaaggtatgtgacaatcagctccctggtgttc
agtatggactcccagttcctgtgtgcctccagcaacacggagaccgtgcacatcttcaag
atggaacacctgacagacagccgcccagaagagccttccacctggagcggctacatggga
aagatgttcatggcagctaccaactacctccccgcccaggtgtcggacatgatgaaccag
gacagggctttcgccacaggacgcctgaacttctctgggcagaagaacatttgcaccctg
tccacgatccagaaactgccgcggttgctggtggcctcctccgacggacacctttacatc
tacaacttggacccacaggatggaggagaatgtgtcctaatcaaaacccacagcttgctt
agctcaggaacaacagaagagaacaaagaaaatgacctcagaccttccttacctccatct
tatgctgcaactgtagcaaggcccagcacgtctgcagcctccacggtgccaggatactct
gaggacggcggggcgctccgaggggaagttattccggaacacgagtttgcgacgggacca
gtgtgtctagacgacgagaatgagtttccccctataatcttgtgccgtggaagtcagaag
ggcaaaacgaagcagtcctga

KEGG   Mus musculus (mouse): 74781
Entry
74781             CDS       T01002                                 

Gene name
Wipi2, 1110018O08Rik, 2510001I10Rik
Definition
(RefSeq) WD repeat domain, phosphoinositide interacting 2
  KO
K17908  autophagy-related protein 18
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    74781 (Wipi2)
   04136 Autophagy - other
    74781 (Wipi2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    74781 (Wipi2)
   05014 Amyotrophic lateral sclerosis
    74781 (Wipi2)
   05016 Huntington disease
    74781 (Wipi2)
   05017 Spinocerebellar ataxia
    74781 (Wipi2)
   05022 Pathways of neurodegeneration - multiple diseases
    74781 (Wipi2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74781 (Wipi2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    74781 (Wipi2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg18-Atg2 complex
    74781 (Wipi2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    74781 (Wipi2)
SSDB
Motif
Pfam: ANAPC4_WD40 VID27
Other DBs
NCBI-GeneID: 74781
NCBI-ProteinID: NP_848485
MGI: 1923831
Ensembl: ENSMUSG00000029578
Vega: OTTMUSG00000026064
UniProt: Q80W47
Position
5; 5 G2
AA seq 445 aa
MNLASQSGEAGAGQLLFANFNQDNTSLAVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCI
VERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLY
IHNIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSASIGEVQVFDTINLRAANMI
PAHDSPLAALAFDASGTKLATASEKGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSM
DGMFLSASSNTETVHIFKLEAVREKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGR
AFATVRLPFCGHKNICSLTTIQKIPRLLVGASDGYLYMYNLDPQEGGECALMRQHRLDGS
METTSEIVDSASHDCPLATQTYGTAAAKGAYVPSSPTRLGKGQDANLEAYTDDLGAVGGA
CLEDEASALRLDEDSEHPPMILRTD
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgaacctggcgagccagagcggagaggccggcgccggccagctgctgttcgccaacttc
aaccaggataacacgtccctagctgttggtagtaagtccgggtataagtttttctccctt
tcttctgtggataagctggaacagatctatgaatgcactgacactgaagatgtctgcatt
gtggagagattgttctcaagcagcttggtggccattgtcagcctcaaagctcccaggaag
ctgaaggtttgccattttaagaagggaactgagatatgcaactacagctactccaacact
atcctggctgtgaagctgaacaggcagcggctcattgtgtgtctggaagagtcgctctac
atacacaacatccgggacatgaaggtacttcataccatccgagagacacccccaaaccct
gcaggcttgtgtgcactgtcaataaacaatgacaactgctacttggcgtatccagggagt
gcgagcattggagaggtgcaggtcttcgacaccattaacttgagagctgcaaacatgatc
ccagctcatgatagtcccttagcagccctggcttttgatgcaagtgggaccaagcttgcc
actgcttctgagaaggggactgtgattcgggtgttttccattccagagggacagaagctg
tttgagttcaggagaggagtgaagaggtgtgtgagcatctgctccctggccttcagcatg
gacggcatgttcctctccgcatccagcaacaccgaaacagtgcacatcttcaaacttgag
gctgtgagggaaaaacctccggaagagcccaccacctggactggctactttgggaaggtt
ctcatggcatctaccagctacctgccctcacaagtgacagaaatgttcaaccagggcagg
gccttcgccactgtccgcctgccattctgtggccacaaaaacatctgctcactaaccaca
attcagaagatcccacggttgctggtaggagcatcagatggctatttgtacatgtacaac
ctggacccccaggagggaggcgagtgtgcgctgatgcgtcagcacaggcttgatggcagt
atggagacgaccagtgaaatcgtagactctgcatctcatgactgccccttagcaacacag
acgtacggcacagcagctgccaaaggtgcctatgtgccctcgtcccccacaagacttggg
aaagggcaggacgccaacttagaagcctacacagatgacctgggtgctgtgggtggtgca
tgcctagaggatgaagccagcgctctgcgcctggatgaagacagcgaacatcctcccatg
attctccggactgactga

DBGET integrated database retrieval system