KEGG   Mus musculus (mouse): 52666
Entry
52666             CDS       T01002                                 

Gene name
Arhgef25, 2410008H17Rik, D10Ertd610, D10Ertd610e, GEFT
Definition
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 25
  KO
K20690  Rho guanine nucleotide exchange factor 25
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    52666 (Arhgef25)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    52666 (Arhgef25)
SSDB
Motif
Pfam: RhoGEF PH PH_10
Other DBs
NCBI-GeneID: 52666
NCBI-ProteinID: NP_082303
MGI: 1277173
Ensembl: ENSMUSG00000019467
UniProt: Q9CWR0 G5E825
Position
10 D3; 10 74.5 cM
AA seq 618 aa
MKPPDRPTPGRTDRILGVMGGMLRACAVPGQEGPPERDPLGPGSTKTESDCIEEDQTGQR
EPEVLAWAPQPESYSIAVSEGSMSASAVSGLAALSGPSSGLSSDPCSPIPPGPVTGLRRW
LDHSKHCLSVETEAESGQTGQCENWTLEPTLTTGQELPELTLLTTLLEGPGDKAQPAEEE
TLSQAPKNEEEQKKMALERSMFVLGELVETERTYVDDLGQIVEGYMATMATQGVPESLRG
RDRIVFGNIQQIYEWHRDYFLQELQQCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEH
VLSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLLLKDFLKYYRRAGKDTEELEQ
AVEVMCFVPKRCNDMMSLGRLRGFEGKLTAQGKLLGQDTFLVTEPEAGGLLSSRGRERRV
FLFEQIIIFSEALGGGGRGGAQPGYVYKNSIKVSCLGLEGNLQGNPCRFALTSRGPEGGI
QRYVLQASDPAVSQAWIKQVAQILESQRDFLNALQSPIEYQRRESQTNSLGRPGGPWVGS
PGRMRPGDLAQASMHTPINGSLPSLLLLPRGEVSRVLLPLDTQALSDTPQTPHDSPALPT
VNTPPCQARLAKLDEDEL
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgaagcccccggaccgccccacccctggccgcactgaccggatactgggggtcatgggt
ggcatgctgcgcgcatgcgccgtacccgggcaggaggggcccccggagagagatccctta
gggcctgggagtaccaagacagagagtgattgtatcgaggaggatcagacagggcagcgc
gaacctgaggtcctcgcctgggctccgcagcccgaatcctattctattgccgtcagtgag
gggagcatgtcagcgtctgctgtctcggggctggctgccctgtctggccccagctctggc
ctcagctctgatccgtgttctccgattccccctggaccagtaactggcctgaggagatgg
ttggatcattccaaacattgtctcagtgtggaaactgaggcagagagtggtcagaccgga
caatgtgagaactggacgctggagccaactttaaccacaggacaagagctgcccgaactg
accttactgactacattgctggagggtcctggagacaaggcacagccagctgaagaggaa
actttgtcccaagctcccaagaatgaggaagagcagaagaagatggctctggaaaggagt
atgtttgtcctgggtgagctggtggaaacagaaagaacatatgtggacgacttgggacag
atcgtagagggttacatggctaccatggctactcagggggtacctgagagtctccgaggt
cgtgacaggattgtgtttgggaacattcagcagatctatgagtggcaccgagactacttc
ctgcaggagctgcagcagtgtttgaaagatcccgattggttggctcagctgttcatcaaa
catgagcgccgactgcatatgtatgtggtgtactgccagaataaacccaagtcagagcat
gtgctgtcagagtttggggacagctactttgaggagctgaggcagcagctgggacaccga
ctgcagctcaatgacctcctcattaaaccagtgcagcgaatcatgaaataccagttgctg
ctgaaggattttctaaagtattacagaagagctgggaaggatactgaagagctggagcaa
gctgtggaggtcatgtgtttcgtacctaagcgatgcaatgatatgatgtccctggggaga
cttcggggatttgagggaaaactgactgctcaggggaagctcttgggccaggacacattc
ttggttacagagcctgaagctgggggtctgctttcttcccggggtcgggagaggcgtgtc
ttcctgttcgagcaaatcatcatcttcagtgaggccctgggaggaggaggccgaggtggc
gcgcagcctggctacgtgtacaagaacagcatcaaggtgagctgcctagggctggagggg
aatctccaaggcaacccttgccggtttgcgctgacctctagagggccagaaggtgggatc
cagcgctacgttctgcaggcttcagaccctgctgtcagtcaagcctggataaagcaagtg
gcccagatcctggaaagccagcgtgactttctcaacgcattacagtcacccattgaatac
cagagacgtgagagccagaccaatagcctggggcgaccaggagggccttgggtagggagc
cctgggagaatgcggcctggagacctggcccaggccagcatgcacacacccatcaatggc
tctctcccttccctgctacttctgcccagaggggaggtgtccagagtgctgttgcccctg
gatacacaggctctcagtgataccccccagactcctcatgactctccagcccttcccact
gtgaacactcctccctgtcaggccaggctcgccaagctggatgaagatgagctgtaa

DBGET integrated database retrieval system